TkAUNG020200 | RubberDandelionOmics

Gene overview

TkAUNG020200

Reference: TK1151 Chr: ChrUn Coordinates: 5427575-5430665 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · TkAUNG020200|TK1151|cDNA

AAACACAATAACACACATCTCGGATTTTTGGAGAAATCGAATTCAGAAAGCATTTTACTGGCCTAAACTGGTGAAAATCTAGGTATCGTAATGAACATAAACATCAAATTCAAACCCACATCTCGGCTGCCCCTGCATTTGATTTCAGAGGATTTAAGACACGTGAGAAGCTTAATTCTCTAATTCAATATGGGGAGAAGAAAGAATTTCCATCAAAATTCAGAGATTCAAAAAAGTGGAAAATTAATTGTCGATTTTCA...

CDS

Download CDS FASTA

1173 bp · TkAUNG020200|TK1151|CDS

ATGGGGAGAAGAAAGAATTTCCATCAAAATTCAGAGATTCAAAAAAGTGGAAAATTAATTGTCGATTTTCACAGTGATACAGACATCAATGAATGCACAAGCGCAAGTACCCAAATTGGATCCAAGAGTTTGAACCACTTCTTAGAACAGTTATATGAAAAAAGGGGGAAAACAAGGGAGGCTGCACTTTCTTCAATAATCCTGAGTTATAGCCTTGGTTATCAATACCAATATTCTGAAAAAAACTTCTCTGAGTTACT...

Protein

Download Protein FASTA

390 aa · TkAUNG020200|TK1151|PROTEIN

MGRRKNFHQNSEIQKSGKLIVDFHSDTDINECTSASTQIGSKSLNHFLEQLYEKRGKTREAALSSIILSYSLGYQYQYSEKNFSELLYQCLKSFKRDSIKESCLALEVLGLLAITIGCGENSHELYKETASILSEALNTESQPQKLKLILDTLAIITFIGGNELEETEKSMQSIWDFMHSRADFKEAQSAAIFSWSLLLSSMDSWTLSYKHWRGAISFFKKLLESDNESIVNGARQALALIFEIGCLEKFEDDTSAMEEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG020200`
TK1151 ID	TkAUNG020200
OH-1004 ID	LXL04_025696
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG020200`
Location	ChrUn:5427575-5430665 (-)
Description	Similar to IFRD1: Interferon-related developmental regulator 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025696` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006417 regulation of translation Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0017148 negative regulation of translation Biological Process GO:0030154 cell differentiation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0030371 translation repressor activity Molecular Function GO:0043022 ribosome binding Molecular Function
KEGG gene cross-reference	hsa:3475 mmu:15983 ssc:493185 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.657

Rank 1 · TkAUNG020200 · TK1151

Cytoplasm0.363

Rank 2 · TkAUNG020200 · TK1151

Cell membrane0.039

Rank 3 · TkAUNG020200 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkAUNG020200 · TK1151

Mitochondrion0.027

Rank 5 · TkAUNG020200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05004IFRD33-259 aa

PF08928PoNi_N56-113 aa

PF04836IFRD_C312-333 aa

PF08928PoNi_N352-378 aa

PF04836IFRD_C360-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG020200	`PF05004`	IFRD	33	259	6.7e-49	167.2
TkAUNG020200	`PF08928`	PoNi_N	56	113	0.17	12.6
TkAUNG020200	`PF04836`	IFRD_C	312	333	4.8e-08	34.2
TkAUNG020200	`PF08928`	PoNi_N	352	378	0.17	12.6
TkAUNG020200	`PF04836`	IFRD_C	360	379	4.8e-08	34.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card