TkAUNG019900 | RubberDandelionOmics

Gene overview

TkAUNG019900

Reference: TK1151 Chr: ChrUn Coordinates: 5324508-5327629 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1161 bp · TkAUNG019900|TK1151|cDNA

GGTGGAGCGCATCTTCCTAGCATACATATTACATACTATTCACGTACGCATGGGTAAAAGTGAAAATTATAAACTTCAGATGCAACACCGTGTACCGCCAATATGCTCATTCCCCTTTGGGTTCCCGCCAAGAGGTCTCTATCACAATCCCCAAATCTCCTTTGCAAATCACACCTCCCCAAACCCTGATCGGCATAAACCAAATTCAAAACATACTCCCCTGATCGGAGAAAATGGATACGAACGGTGGTAGTGGTGCG...

CDS

Download CDS FASTA

819 bp · TkAUNG019900|TK1151|CDS

ATGGATACGAACGGTGGTAGTGGTGCGGCGCCCACTGGTTGTTACAAATGCGGCCGTCCCGGACACTGGTCCCGTGACTGCCCTTCAGACCCCACCTCTAACTCCAACCACGACGGATCTAATAAAAAACCCTCAGCATCATCGCATCCGTTTAAGGCAAGCGGCGGCGTAGGTGGTGACTCATTTTCAGCCCAAAAGCAGCCGATTGAAAAGCCGAAGAAGGTTCCGAAAACCAGACCTAAGCTTACTCCGGAACTTCT...

Protein

Download Protein FASTA

272 aa · TkAUNG019900|TK1151|PROTEIN

MDTNGGSGAAPTGCYKCGRPGHWSRDCPSDPTSNSNHDGSNKKPSASSHPFKASGGVGGDSFSAQKQPIEKPKKVPKTRPKLTPELLLSDDGLGFVLRHFPKAFKYRGRGHEISDLGNLLSMYAEWHSHLIPYYSFNQFVHKTEQIGASKRVKICINDLREKIANGGDPANILETPQQNENSNPQQDVNDVDDLNLHPEDNLPNNDTDMMDDIFETIAQEPSGPLNNEEDTIGEKSAPIEISEEVKARIEENRRKALERA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG019900`
TK1151 ID	TkAUNG019900
OH-1004 ID	LXL04_025693
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG019900`
Location	ChrUn:5324508-5327629 (+)
Description	Similar to tipin: TIMELESS-interacting protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025693` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000076 DNA replication checkpoint signaling Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0031297 replication fork processing Biological Process GO:0031573 mitotic intra-S DNA damage checkpoint signaling Biological Process GO:0033262 regulation of nuclear cell cycle DNA replication Biological Process GO:0043111 replication fork arrest Biological Process GO:0044770 cell cycle phase transition Biological Process GO:0051301 cell division Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	bta:506176 dre:445058 gga:415548 hsa:54962 xla:394376 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.774

Rank 1 · TkAUNG019900 · TK1151

Cytoplasm0.315

Rank 2 · TkAUNG019900 · TK1151

Cell membrane0.030

Rank 3 · TkAUNG019900 · TK1151

Mitochondrion0.026

Rank 4 · TkAUNG019900 · TK1151

Endoplasmic reticulum0.025

Rank 5 · TkAUNG019900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05297Herpes_LMP17-40 aa

PF13917zf-CCHC_312-28 aa

PF00098zf-CCHC13-29 aa

PF30379SLU7_N13-27 aa

PF14787zf-CCHC_514-29 aa

PF13696zf-CCHC_217-28 aa

PF30379SLU7_N69-75 aa

PF07962Swi381-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG019900	`PF05297`	Herpes_LMP1	7	40	0.0039	17.2
TkAUNG019900	`PF13917`	zf-CCHC_3	12	28	0.03	14.9
TkAUNG019900	`PF00098`	zf-CCHC	13	29	2.2e-08	34.5
TkAUNG019900	`PF30379`	SLU7_N	13	27	0.83	9.9
TkAUNG019900	`PF14787`	zf-CCHC_5	14	29	0.0065	16.9
TkAUNG019900	`PF13696`	zf-CCHC_2	17	28	0.027	15.0
TkAUNG019900	`PF30379`	SLU7_N	69	75	0.83	9.9
TkAUNG019900	`PF07962`	Swi3	81	162	5.7e-26	90.9
TkAUNG019900	`PF05297`	Herpes_LMP1	145	248	0.0039	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card