RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG019660
Reference: TK1151 Chr: ChrUn Coordinates: 5260091-5262310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1425 bp · TkAUNG019660|TK1151|cDNA

TCTTTTGACTTCCTGTAATGGCTTCCCATTCCTTAACTCCCAGCAATTTCAGACTCCAACTTCTCATTTCATCGAAACCCCAATTAAACTCAATCCTCAAATCATCTAATCGGTTTCAATTAAGCATACCCACAGCCAGATTTTCTTCATCGATTCGCTCTATGGGTTCTTCGTCTTCTTCATCTCAGAAACCAGACGCCTCAACTCAAGAGGCTGGAAAGATGGATTATAAATCTGTTAGCGAGCAAGAATGGAAGAAG...

CDS

Download CDS FASTA

597 bp · TkAUNG019660|TK1151|CDS

ATGGCTTCCCATTCCTTAACTCCCAGCAATTTCAGACTCCAACTTCTCATTTCATCGAAACCCCAATTAAACTCAATCCTCAAATCATCTAATCGGTTTCAATTAAGCATACCCACAGCCAGATTTTCTTCATCGATTCGCTCTATGGGTTCTTCGTCTTCTTCATCTCAGAAACCAGACGCCTCAACTCAAGAGGCTGGAAAGATGGATTATAAATCTGTTAGCGAGCAAGAATGGAAGAAGAAGCTTAGTGGAGAACA...

Protein

Download Protein FASTA

198 aa · TkAUNG019660|TK1151|PROTEIN

MASHSLTPSNFRLQLLISSKPQLNSILKSSNRFQLSIPTARFSSSIRSMGSSSSSSQKPDASTQEAGKMDYKSVSEQEWKKKLSGEQFYVTRQKGTERAFSGEYWNSKTPGTYHCICCDTPLFESSTKFDSGTGWPSYYQPIGNNVKSKLDLSIIFMPRQEVVCAACDAHLGHVFDDGPPPTGKRYCINSASLKLNPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG019660
TK1151 IDTkAUNG019660
OH-1004 IDLXL04_037813
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG019660
LocationChrUn:5260091-5262310 (-)
DescriptionSimilar to MSRB1: Peptide methionine sulfoxide reductase B1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g53670 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.
The Arabidopsis plastidic methionine sulfoxide reductase B proteins. Sequence and activity characteristics, comparison of the expression with plastidic methionine sulfoxide reductase A, and induction by photooxidative stress.2005 · DOI: 10.1104/pp.105.062430
Specificity of thioredoxins and glutaredoxins as electron donors to two distinct classes of Arabidopsis plastidial methionine sulfoxide reductases B.2007 · DOI: 10.1016/j.febslet.2007.07.081
Regeneration mechanisms of Arabidopsis thaliana methionine sulfoxide reductases B by glutaredoxins and thioredoxins.2009 · DOI: 10.1074/jbc.m109.015487
Arabidopsis thaliana plastidial methionine sulfoxide reductases B, MSRBs, account for most leaf peptide MSR activity and are essential for growth under environmental constraints through a role in the preservation of photosystem antennae.2010 · DOI: 10.1111/j.1365-313x.2009.04053.x
Plant thioredoxin CDSP32 regenerates 1-cys methionine sulfoxide reductase B activity through the direct reduction of sulfenic acid.2010 · DOI: 10.1074/jbc.m110.108373

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0472000 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.
OsMSRA4.1 and OsMSRB1.1, two rice plastidial methionine sulfoxide reductases, are involved in abiotic stress responses.2009 · DOI: 10.1007/s00425-009-0934-2
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006979 response to oxidative stress Biological Process
GO:0030091 protein repair Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009570 chloroplast stroma Cellular Component
GO:0008270 zinc ion binding Molecular Function
GO:0033743 peptide-methionine (R)-S-oxide reductase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
amr:AM1_2115
ath:AT1G53670
avn:Avin_15440
dosa:Os06g0472000
tel:tlr1214
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.693
Rank 1 · TkAUNG019660 · TK1151
Mitochondrion0.318
Rank 2 · TkAUNG019660 · TK1151
Cytoplasm0.084
Rank 3 · TkAUNG019660 · TK1151
Nucleus0.069
Rank 4 · TkAUNG019660 · TK1151
Peroxisome0.020
Rank 5 · TkAUNG019660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24046At4g0833027-42 aa
PF12253CAF1A_dimeriz54-87 aa
PF24046At4g0833056-56 aa
PF01641SelR83-196 aa
PF24046At4g08330111-128 aa
PF03226Yippee-Mis18113-190 aa
PF06677Auto_anti-p27113-126 aa
PF24046At4g08330154-183 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG019660PF24046At4g0833027420.02715.2
TkAUNG019660PF12253CAF1A_dimeriz54870.04914.5
TkAUNG019660PF24046At4g0833056560.02715.2
TkAUNG019660PF01641SelR831962.7e-49166.7
TkAUNG019660PF24046At4g083301111280.02715.2
TkAUNG019660PF03226Yippee-Mis181131900.03515.0
TkAUNG019660PF06677Auto_anti-p271131260.9710.3
TkAUNG019660PF24046At4g083301541830.02715.2
TkAUNG019660PF06677Auto_anti-p271601680.9710.3
TkAUNG019660PF06677Auto_anti-p271821890.9710.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C8M2Arabidopsis thalianasp|Q9C8M2|MSRB1_ARATH Peptide methionine sulfoxide reductase B1, chloroplastic70.700%Swiss-ProtHigh
Q0DC89Oryza sativa subsp. japonicasp|Q0DC89|MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic80.000%Swiss-ProtMedium

JBrowse

View in Genome Browser