TkAUNG019410 | RubberDandelionOmics

Gene overview

TkAUNG019410

Reference: TK1151 Chr: ChrUn Coordinates: 5171991-5172500 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkAUNG019410|TK1151|cDNA

ATGGACACGGTGACAGTAATGATGGAGCTCGACAAGCTTCCTGATCCGTTCTCTCTCCCTTTCCATCACCTTTCTTGTTCATCAAGCATAGATTTCTATGGCAAAAGCCACACCAACAACCACCTCATAAAACCACCGCCGCCGCCAACCTTTTACAGTCACCCTACACCACCACTATCGCCATCCAAGAATCCGGTTCCGGTGGATGCGATGAGGGAGATGATGTTCCAGATGGCGGCGTTGCAGCCGATTCAGATCGA...

CDS

Download CDS FASTA

510 bp · TkAUNG019410|TK1151|CDS

ATGGACACGGTGACAGTAATGATGGAGCTCGACAAGCTTCCTGATCCGTTCTCTCTCCCTTTCCATCACCTTTCTTGTTCATCAAGCATAGATTTCTATGGCAAAAGCCACACCAACAACCACCTCATAAAACCACCGCCGCCGCCAACCTTTTACAGTCACCCTACACCACCACTATCGCCATCCAAGAATCCGGTTCCGGTGGATGCGATGAGGGAGATGATGTTCCAGATGGCGGCGTTGCAGCCGATTCAGATCGA...

Protein

Download Protein FASTA

169 aa · TkAUNG019410|TK1151|PROTEIN

MDTVTVMMELDKLPDPFSLPFHHLSCSSSIDFYGKSHTNNHLIKPPPPPTFYSHPTPPLSPSKNPVPVDAMREMMFQMAALQPIQIDPESVKPPKRRNVKISKDPQSVAARHRRERISERIRTLQRLVPGGTKMDTASMLDEAVHYMKFLKNKSNLLSRRLLAVAWRRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG019410`
TK1151 ID	TkAUNG019410
OH-1004 ID	LXL04_024335
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.349 / OH-1004 79.894 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG019410

Location ChrUn:5171991-5172500 (+)

Description Similar to HEC2: Transcription factor HEC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50330`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At5g67060`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At5g09750`	Required for the female reproductive tract development and fertility.	The HECATE genes regulate female reproductive tract development in Arabidopsis thaliana.2007 · DOI: 10.1242/dev.011510
`At4g00120`	Transcription regulator required for seed dispersal.	No verified direct reference in this release
`At3g21330`	Transcription factor bHLH87.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024335 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010500 transmitting tissue development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048462 carpel formation Biological Process

GO:0048467 gynoecium development Biological Process

GO:0080126 ovary septum development Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G21330

ath:AT3G50330

ath:AT4G00120

ath:AT5G09750

ath:AT5G67060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkAUNG019410 · TK1151

Cytoplasm0.098

Rank 2 · TkAUNG019410 · TK1151

Cell membrane0.021

Rank 3 · TkAUNG019410 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkAUNG019410 · TK1151

Plastid0.010

Rank 5 · TkAUNG019410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH110-151 aa

PF23177bHLH_IRO3111-157 aa

PF23173bHLH_SAC51112-156 aa

PF23176bHLH_LHW114-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG019410	`PF00010`	HLH	110	151	5.8e-08	33.1
TkAUNG019410	`PF23177`	bHLH_IRO3	111	157	0.019	16.1
TkAUNG019410	`PF23173`	bHLH_SAC51	112	156	1.8e-11	44.5
TkAUNG019410	`PF23176`	bHLH_LHW	114	154	1.1e-05	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND4`	Arabidopsis thaliana	sp\|Q9SND4\|HEC2_ARATH Transcription factor HEC2	86.600%	Swiss-Prot	Low
`Q9FHA7`	Arabidopsis thaliana	sp\|Q9FHA7\|HEC1_ARATH Transcription factor HEC1	86.600%	Swiss-Prot	Low
`Q9LXD8`	Arabidopsis thaliana	sp\|Q9LXD8\|HEC3_ARATH Transcription factor HEC3	75.300%	Swiss-Prot	Medium
`O81313`	Arabidopsis thaliana	sp\|O81313\|IND_ARATH Transcription factor IND	63.300%	Swiss-Prot	Medium
`Q8S3D2`	Arabidopsis thaliana	sp\|Q8S3D2\|BH087_ARATH Transcription factor bHLH87	67.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card