TkAUNG017190 | RubberDandelionOmics

Gene overview

TkAUNG017190

Reference: TK1151 Chr: ChrUn Coordinates: 4602080-4603372 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · TkAUNG017190|TK1151|cDNA

ATGCAGTCGTTAGCTCCATCTTCGACTATTAGTATGAAGTCAATAATGCGGACGCCCCAATCAGCCGCAAGCCGTTTTGATTCTGCTTCAAATACGACTAATCCAGCCGTATCTGCGGCGGTGCCGTCCACCAACAACTTATCGTCCGGCGGTGTAGGTAAGAGCCGCACCGATTGGCAAAGCTCGTGTGCTATCCTTGCGAGCAAGGTTGTGTCGCAGCAGCAGAACACAGAGAAGACCGGCGGTGCGGATAATATCAC...

CDS

Download CDS FASTA

1254 bp · TkAUNG017190|TK1151|CDS

ATGCAGTCGTTAGCTCCATCTTCGACTATTAGTATGAAGTCAATAATGCGGACGCCCCAATCAGCCGCAAGCCGTTTTGATTCTGCTTCAAATACGACTAATCCAGCCGTATCTGCGGCGGTGCCGTCCACCAACAACTTATCGTCCGGCGGTGTAGGTAAGAGCCGCACCGATTGGCAAAGCTCGTGTGCTATCCTTGCGAGCAAGGTTGTGTCGCAGCAGCAGAACACAGAGAAGACCGGCGGTGCGGATAATATCAC...

Protein

Download Protein FASTA

417 aa · TkAUNG017190|TK1151|PROTEIN

MQSLAPSSTISMKSIMRTPQSAASRFDSASNTTNPAVSAAVPSTNNLSSGGVGKSRTDWQSSCAILASKVVSQQQNTEKTGGADNITVVNGHKTLDLVPIDNLPKPLTITDLSPAPMHGAQIRVAYQGVPGAYSEAAAGKAYPQCEAIPCDQFEVAFQAVELWIADRAVLPVENSLGGSIHRNYDLLLRHRLHIVGEVQLPVHHCLLALPGVRKEYINRVISHPQALAQCELTLTKLGLNITREAVDDTAGAAEFVAANN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG017190`
TK1151 ID	TkAUNG017190
OH-1004 ID	LXL04_004630
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG017190

Location ChrUn:4602080-4603372 (-)

Description Similar to ADT6: Arogenate dehydratase/prephenate dehydratase 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08250`	Converts the prephenate produced from the shikimate- chorismate pathway into phenylalanine.	Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.2007 · DOI: 10.1074/jbc.m702662200
`At2g27820`	Converts the prephenate produced from the shikimate- chorismate pathway into phenylalanine.	Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.2007 · DOI: 10.1074/jbc.m702662200
`At5g22630`	Converts the prephenate produced from the shikimate-chorismate pathway into phenylalanine.	Phenylalanine biosynthesis in Arabidopsis thaliana. Identification and characterization of arogenate dehydratases.2007 · DOI: 10.1074/jbc.m702662200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004630 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006571 L-tyrosine biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009094 L-phenylalanine biosynthetic process Biological Process

GO:0010244 response to low fluence blue light stimulus by blue low-fluence system Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004664 prephenate dehydratase activity Molecular Function

GO:0047769 arogenate dehydratase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08250

ath:AT2G27820

ath:AT3G44720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.744

Rank 1 · TkAUNG017190 · TK1151

Mitochondrion0.209

Rank 2 · TkAUNG017190 · TK1151

Cytoplasm0.101

Rank 3 · TkAUNG017190 · TK1151

Nucleus0.053

Rank 4 · TkAUNG017190 · TK1151

Peroxisome0.046

Rank 5 · TkAUNG017190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01842ACT77-96 aa

PF00800PDT124-301 aa

PF01842ACT233-266 aa

PF01842ACT325-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG017190	`PF01842`	ACT	77	96	0.0016	18.9
TkAUNG017190	`PF00800`	PDT	124	301	6.2e-60	202.8
TkAUNG017190	`PF01842`	ACT	233	266	0.0016	18.9
TkAUNG017190	`PF01842`	ACT	325	359	0.0016	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGD6`	Arabidopsis thaliana	sp\|Q9SGD6\|AROD6_ARATH Arogenate dehydratase/prephenate dehydratase 6, chloroplastic	79.200%	Swiss-Prot	High
`Q9ZUY3`	Arabidopsis thaliana	sp\|Q9ZUY3\|AROD3_ARATH Arogenate dehydratase 3, chloroplastic	79.200%	Swiss-Prot	High
`Q9FNJ8`	Arabidopsis thaliana	sp\|Q9FNJ8\|AROD5_ARATH Arogenate dehydratase 5, chloroplastic	76.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card