RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG016640
Reference: TK1151 Chr: ChrUn Coordinates: 4449586-4452561 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2260 bp · TkAUNG016640|TK1151|cDNA

CTTATTTTCTTGTCCATAACTCCAAAAAGAAGGTCCCTTTTCTGAAATTTCAGAATTTTATTTCATTTCCCATTTTGCCCCTCTCGTCTCGTCTACCTCGTCCAACTGAAACACCCCTGCTTCTTCCCATAGTGAAAGCAAAAGCGAAGACACACATTCCAGTGTGTGTTCCTGCGTGAGAGAGAAAGCTTTACCTACAGTAAAACCCTAGGAGGAGGAGGAGCGCATACGGAGATTCTGTGGTCTCATGAAGGGTTACA...

CDS

Download CDS FASTA

2013 bp · TkAUNG016640|TK1151|CDS

ATGAAGGGTTACAGAGACAATGGTAGTGCTGCTGGTGGCTTTGGAGCGCGAAATAAGACAGTGTATGACGACGTATTTGGTGGTCCGCCCAAATTTGGAGCCACGACTCTTCCTCCTCGTCTCGAGGATTACACTGAGATTTTTCAAGGCTTTCACGCTTCCCGAGGCTCTTCAATTCCCGTTTTAGATCTTCCGCCGCCGTCTAACGAATCCGACGACGTCTGGTTTGATGTTCAGAGCTCTAAGCTTGATTACTCTGA...

Protein

Download Protein FASTA

671 aa · TkAUNG016640|TK1151|PROTEIN

MKGYRDNGSAAGGFGARNKTVYDDVFGGPPKFGATTLPPRLEDYTEIFQGFHASRGSSIPVLDLPPPSNESDDVWFDVQSSKLDYSEVFGGFKGLDFAISYEELFNISKVGDGDSSDDLWTPAQSETLSDELDPYTSLEINQQVSTTDEIFGEQLQNEPTFEAEKDVSNGIIYDSEFLDDPSEKENEKSFSLANNDHSSSNHGVIEKKQLQKSLSEPLDSVYKQHFSVCDLSLKTQPSNLPPPSRPPPVLSSKKGDMDTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG016640
TK1151 IDTkAUNG016640
OH-1004 IDLXL04_024601
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)95.200
Protein coverage (%)TK1151 100.000 / OH-1004 80.240
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG016640
LocationChrUn:4449586-4452561 (+)
DescriptionSimilar to AUL1: Auxilin-like protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024601 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007015 actin filament organization Biological Process
GO:0009903 chloroplast avoidance movement Biological Process
GO:0009904 chloroplast accumulation movement Biological Process
GO:0045806 negative regulation of endocytosis Biological Process
GO:0045926 negative regulation of growth Biological Process
GO:0071483 cellular response to blue light Biological Process
GO:0072318 clathrin coat disassembly Biological Process
GO:0072583 clathrin-dependent endocytosis Biological Process
GO:0080183 response to photooxidative stress Biological Process
GO:1900186 negative regulation of clathrin-dependent endocytosis Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G75100
ath:AT1G75310
ath:AT4G12770
ath:AT4G12780
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.552
Rank 1 · TkAUNG016640 · TK1151
Nucleus0.242
Rank 2 · TkAUNG016640 · TK1151
Cell membrane0.178
Rank 3 · TkAUNG016640 · TK1151
Golgi apparatus0.080
Rank 4 · TkAUNG016640 · TK1151
Endoplasmic reticulum0.058
Rank 5 · TkAUNG016640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser