TkAUNG013860 | RubberDandelionOmics

Gene overview

TkAUNG013860

Reference: TK1151 Chr: ChrUn Coordinates: 3544043-3545921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1315 bp · TkAUNG013860|TK1151|cDNA

ACAAACATTCATACTCTCTCTCACCTAAAACATTCATCTCCGCGAATCTCTATCTGTCAGAAACACCGGAGGAAATGGGAAGCTTGAAAGAAGAGAGGAAAACCACCGGCTGGGCTGCCAGAGATCCTTCCGGCGTCCTCTCCCCATACACCTTCACTCTCCGAAATACAGGAGCAGAAGACGTGTTGATAAAGGTGATATGCTGTGGAGTTTGCCATACTGATCTTCATCAGATAAAAAATGACCTCGGAATGTCGAAC...

CDS

Download CDS FASTA

813 bp · TkAUNG013860|TK1151|CDS

ATGGGAAGCTTGAAAGAAGAGAGGAAAACCACCGGCTGGGCTGCCAGAGATCCTTCCGGCGTCCTCTCCCCATACACCTTCACTCTCCGAAATACAGGAGCAGAAGACGTGTTGATAAAGGTGATATGCTGTGGAGTTTGCCATACTGATCTTCATCAGATAAAAAATGACCTCGGAATGTCGAACTACCCCATGGTTCCTGGACACGAAGTAGTAGGTGAGGTGGTGGAGGTGGGACCGGAAGTCACCAAATTCAAGGT...

Protein

Download Protein FASTA

270 aa · TkAUNG013860|TK1151|PROTEIN

MGSLKEERKTTGWAARDPSGVLSPYTFTLRNTGAEDVLIKVICCGVCHTDLHQIKNDLGMSNYPMVPGHEVVGEVVEVGPEVTKFKVGDCVGVGCLVGCCESCLPCEAEVEQYCNKKIWSYNDVYTDGKPTQGGFAGSMVVHQKFVVKIPEGMSPEQVAPLLCAGVTVYSPLTHFGLTKSGLKGGILGLGGVGHMGVLIAKAMGHHVTVISSSDKKKERQWMSSELMIISSAPMFKECKNWQIRLITSLTLCQYTILSSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG013860`
TK1151 ID	TkAUNG013860
OH-1004 ID	LXL04_038447
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 80.741 / OH-1004 56.041 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG013860

Location ChrUn:3544043-3545921 (-)

Description Similar to CAD1: Probable cinnamyl alcohol dehydrogenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19450`	Involved in lignin biosynthesis in the floral stem.	Expression pattern of two paralogs encoding cinnamyl alcohol dehydrogenases in Arabidopsis. Isolation and characterization of the corresponding mutants.2003 · DOI: 10.1104/pp.103.021048 Functional reclassification of the putative cinnamyl alcohol dehydrogenase multigene family in Arabidopsis.2004 · DOI: 10.1073/pnas.0307987100 CINNAMYL ALCOHOL DEHYDROGENASE-C and -D are the primary genes involved in lignin biosynthesis in the floral stem of Arabidopsis.2005 · DOI: 10.1105/tpc.105.030767
`At4g34230`	Involved in lignin biosynthesis in the floral stem.	Expression pattern of two paralogs encoding cinnamyl alcohol dehydrogenases in Arabidopsis. Isolation and characterization of the corresponding mutants.2003 · DOI: 10.1104/pp.103.021048 Functional reclassification of the putative cinnamyl alcohol dehydrogenase multigene family in Arabidopsis.2004 · DOI: 10.1073/pnas.0307987100 CINNAMYL ALCOHOL DEHYDROGENASE-C and -D are the primary genes involved in lignin biosynthesis in the floral stem of Arabidopsis.2005 · DOI: 10.1105/tpc.105.030767

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038447 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0045551 cinnamyl-alcohol dehydrogenase activity Molecular Function

GO:0050268 coniferyl-alcohol dehydrogenase activity Molecular Function

KEGG gene cross-reference

cann:107840223

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.368

Rank 1 · TkAUNG013860 · TK1151

Peroxisome0.245

Rank 2 · TkAUNG013860 · TK1151

Mitochondrion0.187

Rank 3 · TkAUNG013860 · TK1151

Nucleus0.121

Rank 4 · TkAUNG013860 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkAUNG013860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N34-151 aa

PF07240Turandot102-142 aa

PF028262-Hacid_dh_C178-218 aa

PF00107ADH_zinc_N191-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG013860	`PF08240`	ADH_N	34	151	3.7e-26	92.1
TkAUNG013860	`PF07240`	Turandot	102	142	0.003	17.9
TkAUNG013860	`PF02826`	2-Hacid_dh_C	178	218	0.012	15.6
TkAUNG013860	`PF00107`	ADH_zinc_N	191	218	0.00019	22.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P48523`	Arabidopsis thaliana	sp\|P48523\|CADH4_ARATH Cinnamyl alcohol dehydrogenase 4	77.500%	Swiss-Prot	High
`O49482`	Arabidopsis thaliana	sp\|O49482\|CADH5_ARATH Cinnamyl alcohol dehydrogenase 5	80.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card