TkAUNG012280 | RubberDandelionOmics

Gene overview

TkAUNG012280

Reference: TK1151 Chr: ChrUn Coordinates: 2973628-2974074 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · TkAUNG012280|TK1151|cDNA

ATGACAACGATGATAGGTTCATTGCCCCTTCTTCAAGTTCTCAAACTCAAACGCCATTCCTTCATTGGACAGGAGTGGGAAACAATTGAAGAGCAATTCCGCAGTCTCAAATTCTTACTAATTGAGGGTTGTCCCGACCTGAAATACTGGAAGATGGACAGCACTCACTTTCCACGCCTTGAGCACCTACAACTTCGAGGTCTGAAAGAATTGACAGAGATCCCTTCAGATGTTGGAGAAATTCCAACACTACGATCAAT...

CDS

Download CDS FASTA

447 bp · TkAUNG012280|TK1151|CDS

ATGACAACGATGATAGGTTCATTGCCCCTTCTTCAAGTTCTCAAACTCAAACGCCATTCCTTCATTGGACAGGAGTGGGAAACAATTGAAGAGCAATTCCGCAGTCTCAAATTCTTACTAATTGAGGGTTGTCCCGACCTGAAATACTGGAAGATGGACAGCACTCACTTTCCACGCCTTGAGCACCTACAACTTCGAGGTCTGAAAGAATTGACAGAGATCCCTTCAGATGTTGGAGAAATTCCAACACTACGATCAAT...

Protein

Download Protein FASTA

148 aa · TkAUNG012280|TK1151|PROTEIN

MTTMIGSLPLLQVLKLKRHSFIGQEWETIEEQFRSLKFLLIEGCPDLKYWKMDSTHFPRLEHLQLRGLKELTEIPSDVGEIPTLRSIKLVNCSHSTVVSAKRILDDQEELGNEGLQVRVKLNECDKAVESLASQNFQVEIRYELIFFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012280`
TK1151 ID	TkAUNG012280
OH-1004 ID	LXL04_023388
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	45.100
Protein coverage (%)	TK1151 76.351 / OH-1004 11.740 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG012280`
Location	ChrUn:2973628-2974074 (-)
Description	Similar to R1A-6: Putative late blight resistance protein homolog R1A-6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023388` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009626 plant-type hypersensitive response Biological Process GO:0051607 defense response to virus Biological Process GO:0005737 cytoplasm Cellular Component GO:0016020 membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0043531 ADP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.581

Rank 1 · TkAUNG012280 · TK1151

Cytoplasm0.476

Rank 2 · TkAUNG012280 · TK1151

Cell membrane0.079

Rank 3 · TkAUNG012280 · TK1151

Endoplasmic reticulum0.059

Rank 4 · TkAUNG012280 · TK1151

Mitochondrion0.026

Rank 5 · TkAUNG012280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF12-131 aa

PF23598LRR_144-97 aa

PF25019LRR_R13L1-DRL215-17 aa

PF23247LRR_RPS227-73 aa

PF25019LRR_R13L1-DRL2135-92 aa

PF23247LRR_RPS256-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012280	`PF23622`	LRR_At1g61320_AtMIF1	2	131	0.068	13.3
TkAUNG012280	`PF23598`	LRR_14	4	97	0.00045	19.8
TkAUNG012280	`PF25019`	LRR_R13L1-DRL21	5	17	0.00093	19.8
TkAUNG012280	`PF23247`	LRR_RPS2	27	73	0.043	14.5
TkAUNG012280	`PF25019`	LRR_R13L1-DRL21	35	92	0.00093	19.8
TkAUNG012280	`PF23247`	LRR_RPS2	56	94	0.043	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card