TkAUNG012180 | RubberDandelionOmics

Gene overview

TkAUNG012180

Reference: TK1151 Chr: ChrUn Coordinates: 2919103-2929789 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · TkAUNG012180|TK1151|cDNA

ATGAAGATCAAAGGAAGTAAAGTCGCCGTAGGAAATTGGAGCAGCCTAGGGTTGCCGTCGATTTTCCTCTTGTGCCTCTTCTTCTTCCTTGCCGGCTTTTTTGGCTCTTCACTTTTCTCTCAGCAGGAGATGCCGAGTGATATGAGGCCGCGGATTCGAAAAATGGTGGAAGAGAAGATAGAATTTGAGGCGCTGCCGCATGGAGATTCCGGCGAAGAGTCTGTGGAGGAGATCCCCTTTCAGATCCTGAGCTGGAACCC...

CDS

Download CDS FASTA

876 bp · TkAUNG012180|TK1151|CDS

ATGAAGATCAAAGGAAGTAAAGTCGCCGTAGGAAATTGGAGCAGCCTAGGGTTGCCGTCGATTTTCCTCTTGTGCCTCTTCTTCTTCCTTGCCGGCTTTTTTGGCTCTTCACTTTTCTCTCAGCAGGAGATGCCGAGTGATATGAGGCCGCGGATTCGAAAAATGGTGGAAGAGAAGATAGAATTTGAGGCGCTGCCGCATGGAGATTCCGGCGAAGAGTCTGTGGAGGAGATCCCCTTTCAGATCCTGAGCTGGAACCC...

Protein

Download Protein FASTA

291 aa · TkAUNG012180|TK1151|PROTEIN

MKIKGSKVAVGNWSSLGLPSIFLLCLFFFLAGFFGSSLFSQQEMPSDMRPRIRKMVEEKIEFEALPHGDSGEESVEEIPFQILSWNPGLYIFLILLLQNNARHYQNGKSTSQTIILSLRQGETAENTQGIRTSSGMFISSSEDKTGILDQIEEKIAKATMIPRNHGESFNVLRYEIGQRYHSHYDAFNPAEYGPQKSQRVASFLLYLSDVEEGGETMFPFENGQNMDNTYDFRKCVGLKVKPRRGDGLLFYSLFPNGTID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012180`
TK1151 ID	TkAUNG012180
OH-1004 ID	LXL04_006726
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.800
Protein coverage (%)	TK1151 98.282 / OH-1004 97.611 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012180

Location ChrUn:2919103-2929789 (-)

Description Similar to P4H9: Probable prolyl 4-hydroxylase 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33910`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At2g23096`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At5g66060`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At3g28480`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release
`At1g20270`	Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in proline-rich peptide sequences of plant glycoproteins and other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006726 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0080147 root hair cell development Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G20270

ath:AT2G17720

ath:AT2G23096

ath:AT4G33910

ath:AT5G66060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.488

Rank 1 · TkAUNG012180 · TK1151

Endoplasmic reticulum0.354

Rank 2 · TkAUNG012180 · TK1151

Cytoplasm0.066

Rank 3 · TkAUNG012180 · TK1151

Extracellular0.053

Rank 4 · TkAUNG012180 · TK1151

Lysosome / Vacuole0.050

Rank 5 · TkAUNG012180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25410PH_3496-206 aa

PF031712OG-FeII_Oxy167-283 aa

PF136402OG-FeII_Oxy_3170-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012180	`PF25410`	PH_34	96	206	0.11	13.0
TkAUNG012180	`PF03171`	2OG-FeII_Oxy	167	283	4.4e-06	27.7
TkAUNG012180	`PF13640`	2OG-FeII_Oxy_3	170	283	1.4e-16	61.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZJ7`	Arabidopsis thaliana	sp\|Q8VZJ7\|P4H9_ARATH Probable prolyl 4-hydroxylase 9	62.300%	Swiss-Prot	High
`F4ILF8`	Arabidopsis thaliana	sp\|F4ILF8\|P4H13_ARATH Prolyl 4-hydroxylase 13	53.900%	Swiss-Prot	High
`F4JZ24`	Arabidopsis thaliana	sp\|F4JZ24\|P4H10_ARATH Probable prolyl 4-hydroxylase 10	40.600%	Swiss-Prot	Medium
`Q8L970`	Arabidopsis thaliana	sp\|Q8L970\|P4H7_ARATH Probable prolyl 4-hydroxylase 7	41.700%	Swiss-Prot	Medium
`Q9LN20`	Arabidopsis thaliana	sp\|Q9LN20\|P4H3_ARATH Probable prolyl 4-hydroxylase 3	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card