TkAUNG011790 | RubberDandelionOmics

Gene overview

TkAUNG011790

Reference: TK1151 Chr: ChrUn Coordinates: 2818664-2819493 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · TkAUNG011790|TK1151|cDNA

ATGGACGAGGTAGTAGTAGATCCAGCCATTACTATCAAAGCTATTGGACATCAATGGTATTGGACTTATGAGTATTCGGACTATAACAGTTCCGATGAACAGTCACTCACTTTTGACAGTTATACGATTCCAGAAGATGATCCAGAATTGGGTCAATCACGTTTATTAGAAGTGGACAATAGAGTGGTTGTACCAGAAAAAAGTCATTTACGTGTCAAATGTGATGCTGTACCTGGTCGTTTAAATCAGACCTCTATTTC...

CDS

Download CDS FASTA

675 bp · TkAUNG011790|TK1151|CDS

ATGGACGAGGTAGTAGTAGATCCAGCCATTACTATCAAAGCTATTGGACATCAATGGTATTGGACTTATGAGTATTCGGACTATAACAGTTCCGATGAACAGTCACTCACTTTTGACAGTTATACGATTCCAGAAGATGATCCAGAATTGGGTCAATCACGTTTATTAGAAGTGGACAATAGAGTGGTTGTACCAGAAAAAAGTCATTTACGTGTCAAATGTGATGCTGTACCTGGTCGTTTAAATCAGACCTCTATTTC...

Protein

Download Protein FASTA

224 aa · TkAUNG011790|TK1151|PROTEIN

MDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPEKSHLRVKCDAVPGRLNQTSISVQREGVYYGQCSEICGTNHAFMRAPGNIGRLLSQSGLSRTTQGASHPRSKLLQRAAGAPERPASEWLVVNSALVDGIPLCGWHSRNHGTLHTEQASLRDETPAQGPQFSLGGRTKDLWKSGLPRPHGQRNSVPEGGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG011790`
TK1151 ID	TkAUNG011790
OH-1004 ID	LXL04_040167
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.200
Protein coverage (%)	TK1151 35.714 / OH-1004 19.444 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG011790

Location ChrUn:2818664-2819493 (+)

Description Similar to COX2: Cytochrome c oxidase subunit 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`AtMg00160`	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_040167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0045259 proton-transporting ATP synthase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Molecular Function

GO:0051087 protein-folding chaperone binding Molecular Function

KEGG gene cross-reference

han:18250974

rsz:13630159

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.290

Rank 1 · TkAUNG011790 · TK1151

Cytoplasm0.268

Rank 2 · TkAUNG011790 · TK1151

Plastid0.174

Rank 3 · TkAUNG011790 · TK1151

Nucleus0.167

Rank 4 · TkAUNG011790 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkAUNG011790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00116COX210-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG011790	`PF00116`	COX2	10	109	6.3e-40	136.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93285`	Arabidopsis thaliana	sp\|P93285\|COX2_ARATH Cytochrome c oxidase subunit 2	79.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card