TkAUNG009950 | RubberDandelionOmics

Gene overview

TkAUNG009950

Reference: TK1151 Chr: ChrUn Coordinates: 2465327-2466385 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1059 bp · TkAUNG009950|TK1151|cDNA

ATGAGTTATTTTATGTTGGATGAAACCATGGGTGTGAGAACCAACCTCATACCATCAAAGGATGGACCACTAATCCAGGATATCTATGATTTCTTCAGGATGGAGCTCCTATCATTCCTTAAAGAAGAGTTAGATGAACATGTTTATACCAGCATTGAAAGTTTCTTCAGTCGTAAGCTTGTTAAGAGTATTTTTATGCCACTCATTTATGGTAAAACTTTAATGAGTACCAACGATGATATCAAAGCAGAGCTTTCTCA...

CDS

Download CDS FASTA

1059 bp · TkAUNG009950|TK1151|CDS

ATGAGTTATTTTATGTTGGATGAAACCATGGGTGTGAGAACCAACCTCATACCATCAAAGGATGGACCACTAATCCAGGATATCTATGATTTCTTCAGGATGGAGCTCCTATCATTCCTTAAAGAAGAGTTAGATGAACATGTTTATACCAGCATTGAAAGTTTCTTCAGTCGTAAGCTTGTTAAGAGTATTTTTATGCCACTCATTTATGGTAAAACTTTAATGAGTACCAACGATGATATCAAAGCAGAGCTTTCTCA...

Protein

Download Protein FASTA

352 aa · TkAUNG009950|TK1151|PROTEIN

MSYFMLDETMGVRTNLIPSKDGPLIQDIYDFFRMELLSFLKEELDEHVYTSIESFFSRKLVKSIFMPLIYGKTLMSTNDDIKAELSQYMTHKECYNITRLCFKFWSTKYKHMDCLIRLIRIIGWFASTCDRPVLYKTPYFTTSQDYRVMEPHSIWVYDKKSHKRRKVTLRVSSDTRDRKKTEVSTFVNFIHQKDAYIAMCVVLGMTLYNSPIYTVHDNFITNASNSFRLPDLYLNTLKSMGPPLKRINEFLILNLFIPVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG009950`
TK1151 ID	TkAUNG009950
OH-1004 ID	LXL04_039979
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	44.200
Protein coverage (%)	TK1151 99.716 / OH-1004 57.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG009950`
Location	ChrUn:2465327-2466385 (-)
Description	Similar to Probable DNA-directed RNA polymerase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039979` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006390 mitochondrial transcription Biological Process GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0034245 mitochondrial DNA-directed RNA polymerase complex Cellular Component GO:0001018 mitochondrial promoter sequence-specific DNA binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003899 DNA-directed RNA polymerase activity Molecular Function
KEGG gene cross-reference	nsy:104216269 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.342

Rank 1 · TkAUNG009950 · TK1151

Cytoplasm0.311

Rank 2 · TkAUNG009950 · TK1151

Nucleus0.170

Rank 3 · TkAUNG009950 · TK1151

Plastid0.099

Rank 4 · TkAUNG009950 · TK1151

Peroxisome0.071

Rank 5 · TkAUNG009950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00940RNA_pol6-225 aa

PF14033DUF424657-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG009950	`PF00940`	RNA_pol	6	225	2.2e-11	44.0
TkAUNG009950	`PF14033`	DUF4246	57	118	0.052	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card