TkAUNG006600 | RubberDandelionOmics

Gene overview

TkAUNG006600

Reference: TK1151 Chr: ChrUn Coordinates: 1841170-1841592 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkAUNG006600|TK1151|cDNA

ATGGAATTCTCTCCGAGAGCTGCTGAACTAACGACTCTATTAGAAAGTAGAATTAGCAACTTTTACACGAATTTTCAAGTGGATGAGATTGGTCGAGTGGTCTCAGTTGGAGATGGGATTGCACGTGTTTATGGGTTGAACGAGATTCAAGCTGGGGAAATGGTGGAATTTGCCAGCGGTGTGAAAGGAATAGCCTTGAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATACTGCTATTAAAGAAGG...

CDS

Download CDS FASTA

423 bp · TkAUNG006600|TK1151|CDS

ATGGAATTCTCTCCGAGAGCTGCTGAACTAACGACTCTATTAGAAAGTAGAATTAGCAACTTTTACACGAATTTTCAAGTGGATGAGATTGGTCGAGTGGTCTCAGTTGGAGATGGGATTGCACGTGTTTATGGGTTGAACGAGATTCAAGCTGGGGAAATGGTGGAATTTGCCAGCGGTGTGAAAGGAATAGCCTTGAATCTTGAGAATGAGAATGTAGGGATTGTTGTCTTTGGTAGTGATACTGCTATTAAAGAAGG...

Protein

Download Protein FASTA

140 aa · TkAUNG006600|TK1151|PROTEIN

MEFSPRAAELTTLLESRISNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGRGALSDHERAKTCRSESPWDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG006600`
TK1151 ID	TkAUNG006600
OH-1004 ID	LXL04_011315
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.500
Protein coverage (%)	TK1151 45.000 / OH-1004 11.511 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG006600

Location ChrUn:1841170-1841592 (+)

Description Similar to ATPB: ATP synthase subunit beta, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0C520`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release
`UniProt: P0C521`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release
`UniProt: P0C522`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011315 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0045259 proton-transporting ATP synthase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Molecular Function

KEGG gene cross-reference

dosa:Os05g0553000

zma:542267

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.654

Rank 1 · TkAUNG006600 · TK1151

Cytoplasm0.243

Rank 2 · TkAUNG006600 · TK1151

Nucleus0.093

Rank 3 · TkAUNG006600 · TK1151

Peroxisome0.066

Rank 4 · TkAUNG006600 · TK1151

Mitochondrion0.065

Rank 5 · TkAUNG006600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02874ATP-synt_ab_N27-94 aa

PF09378HAS-barrel29-81 aa

PF09378HAS-barrel75-115 aa

PF02874ATP-synt_ab_N107-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG006600	`PF02874`	ATP-synt_ab_N	27	94	2.6e-21	76.6
TkAUNG006600	`PF09378`	HAS-barrel	29	81	0.00015	22.6
TkAUNG006600	`PF09378`	HAS-barrel	75	115	0.00015	22.6
TkAUNG006600	`PF02874`	ATP-synt_ab_N	107	112	2.6e-21	76.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C520`	Oryza sativa	sp\|P0C520\|ATPAM_ORYSA ATP synthase subunit alpha, mitochondrial	96.200%	Swiss-Prot	High
`P0C521`	Oryza sativa subsp. indica	sp\|P0C521\|ATPAM_ORYSI ATP synthase subunit alpha, mitochondrial	96.200%	Swiss-Prot	High
`P0C522`	Oryza sativa subsp. japonica	sp\|P0C522\|ATPAM_ORYSJ ATP synthase subunit alpha, mitochondrial	96.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card