TkAUNG001810 | RubberDandelionOmics

Gene overview

TkAUNG001810

Reference: TK1151 Chr: ChrUn Coordinates: 524159-527818 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2466 bp · TkAUNG001810|TK1151|cDNA

ATGGAGATGGCTATCCATGATACGTGCAAAATTACAAAGAGTGCTTGTTCATGCCCAATTTTGCACTTCAAGGATACTCAGGGAAGCCCGACTCGGTCAGTTTATGAAGTAATGGACCTTATGGACCACAAACAAGTTCATGCAATTATCGGAACTATAAGCCCTCAAGAAGCCACATTAGTTGCCGAGTTTGATAAGGCTACCAAGAACATCCCAATCATTTCTCTAACCCCAACATCCACATCCTTACTTCCCCTATC...

CDS

Download CDS FASTA

2466 bp · TkAUNG001810|TK1151|CDS

ATGGAGATGGCTATCCATGATACGTGCAAAATTACAAAGAGTGCTTGTTCATGCCCAATTTTGCACTTCAAGGATACTCAGGGAAGCCCGACTCGGTCAGTTTATGAAGTAATGGACCTTATGGACCACAAACAAGTTCATGCAATTATCGGAACTATAAGCCCTCAAGAAGCCACATTAGTTGCCGAGTTTGATAAGGCTACCAAGAACATCCCAATCATTTCTCTAACCCCAACATCCACATCCTTACTTCCCCTATC...

Protein

Download Protein FASTA

821 aa · TkAUNG001810|TK1151|PROTEIN

MEMAIHDTCKITKSACSCPILHFKDTQGSPTRSVYEVMDLMDHKQVHAIIGTISPQEATLVAEFDKATKNIPIISLTPTSTSLLPLSISSFVQMSHDITTHMQCIASIIGHFNWKKVTPIYEDHGTFSSNHGFLIHLSDALQLVGSTIESHFTFPPLNSLTNPSIFIEEKLTKLKMNGNRVFILLQSSLSSCILLFEKAKKLGMMEQGYVWIISDDISSLLDSVDQSVILSMQGVVGFKTNFEDTPDSFRDFKLQFRRKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG001810`
TK1151 ID	TkAUNG001810
OH-1004 ID	LXL04_030351
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 93.615 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG001810

Location ChrUn:524159-527818 (+)

Description Similar to GLR2.9: Glutamate receptor 2.9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29100`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At2g29120`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At5g11210`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At2g29110`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release
`At5g11180`	Glutamate-gated receptor that probably acts as a non-selective cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0071230 cellular response to amino acid stimulus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004930 G protein-coupled receptor activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

GO:0008066 glutamate receptor activity Molecular Function

GO:0015276 ligand-gated monoatomic ion channel activity Molecular Function

GO:0038023 signaling receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G24720

ath:AT2G29100

ath:AT2G29120

ath:AT5G11180

ath:AT5G11210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.849

Rank 1 · TkAUNG001810 · TK1151

Cytoplasm0.079

Rank 2 · TkAUNG001810 · TK1151

Endoplasmic reticulum0.061

Rank 3 · TkAUNG001810 · TK1151

Extracellular0.035

Rank 4 · TkAUNG001810 · TK1151

Nucleus0.032

Rank 5 · TkAUNG001810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01094ANF_receptor22-336 aa

PF13458Peripla_BP_624-321 aa

PF00497SBP_bac_3407-722 aa

PF10613Lig_chan-Glu_bd416-492 aa

PF01094ANF_receptor423-481 aa

PF00060Lig_chan509-756 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG001810	`PF01094`	ANF_receptor	22	336	1.8e-42	146.4
TkAUNG001810	`PF13458`	Peripla_BP_6	24	321	2.7e-09	37.9
TkAUNG001810	`PF00497`	SBP_bac_3	407	722	5e-13	49.7
TkAUNG001810	`PF10613`	Lig_chan-Glu_bd	416	492	8.7e-06	26.6
TkAUNG001810	`PF01094`	ANF_receptor	423	481	1.8e-42	146.4
TkAUNG001810	`PF00060`	Lig_chan	509	756	2.6e-17	63.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81078`	Arabidopsis thaliana	sp\|O81078\|GLR29_ARATH Glutamate receptor 2.9	30.900%	Swiss-Prot	Medium
`Q8LGN0`	Arabidopsis thaliana	sp\|Q8LGN0\|GLR27_ARATH Glutamate receptor 2.7	30.100%	Swiss-Prot	Medium
`Q9LFN5`	Arabidopsis thaliana	sp\|Q9LFN5\|GLR25_ARATH Glutamate receptor 2.5	30.700%	Swiss-Prot	Medium
`Q9C5V5`	Arabidopsis thaliana	sp\|Q9C5V5\|GLR28_ARATH Glutamate receptor 2.8	29.600%	Swiss-Prot	Low
`Q9LFN8`	Arabidopsis thaliana	sp\|Q9LFN8\|GLR26_ARATH Glutamate receptor 2.6	29.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card