TkAUNG001090 | RubberDandelionOmics

Gene overview

TkAUNG001090

Reference: TK1151 Chr: ChrUn Coordinates: 278696-279046 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

351 bp · TkAUNG001090|TK1151|cDNA

ATGTTTCACATCCTTTATCAGATCAATAATGTGAAACTTACAGAATTAAGTATTCGTTTGAGGGAATCAGGATATCAGCCAGATACAAATTATGTACTCCATGATCTAGAAGAGGAACAAAAAGAAGTCATCCTTTCTCGGCACAGTGAGAGGCTGGCTATTGCCTTTGGATTAATATCACTACCTCATGGCATTCCTATACGTGTCATAAAAAATCTTAGGGTTTGTGGTGACTGTCATACTGTGATTAAGCTAATTTC...

CDS

Download CDS FASTA

351 bp · TkAUNG001090|TK1151|CDS

ATGTTTCACATCCTTTATCAGATCAATAATGTGAAACTTACAGAATTAAGTATTCGTTTGAGGGAATCAGGATATCAGCCAGATACAAATTATGTACTCCATGATCTAGAAGAGGAACAAAAAGAAGTCATCCTTTCTCGGCACAGTGAGAGGCTGGCTATTGCCTTTGGATTAATATCACTACCTCATGGCATTCCTATACGTGTCATAAAAAATCTTAGGGTTTGTGGTGACTGTCATACTGTGATTAAGCTAATTTC...

Protein

Download Protein FASTA

116 aa · TkAUNG001090|TK1151|PROTEIN

MFHILYQINNVKLTELSIRLRESGYQPDTNYVLHDLEEEQKEVILSRHSERLAIAFGLISLPHGIPIRVIKNLRVCGDCHTVIKLISKIEGREIVVRDSNRFHHFDKGLCSCGDYW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG001090`
TK1151 ID	TkAUNG001090
OH-1004 ID	LXL04_004682
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.900
Protein coverage (%)	TK1151 98.276 / OH-1004 13.058 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG001090

Location ChrUn:278696-279046 (+)

Description Similar to PCMP-H60: Pentatricopeptide repeat-containing protein At2g27610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27610`	Pentatricopeptide repeat-containing protein At2g27610.	No verified direct reference in this release
`At1g56690`	Pentatricopeptide repeat-containing protein At1g56690, mitochondrial.	No verified direct reference in this release
`At1g47580`	Plays a major role in single RNA editing events in chloroplasts.	Two interacting proteins are necessary for the editing of the NdhD-1 site in Arabidopsis plastids.2012 · DOI: 10.1105/tpc.112.099507
`At4g30700`	Pentatricopeptide repeat-containing protein At4g30700.	No verified direct reference in this release
`At4g33990`	Pentatricopeptide repeat-containing protein At4g33990.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004682 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009451 RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G27610

ath:AT4G13650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.406

Rank 1 · TkAUNG001090 · TK1151

Cytoplasm0.406

Rank 2 · TkAUNG001090 · TK1151

Extracellular0.095

Rank 3 · TkAUNG001090 · TK1151

Mitochondrion0.063

Rank 4 · TkAUNG001090 · TK1151

Plastid0.063

Rank 5 · TkAUNG001090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14432DYW_deaminase24-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG001090	`PF14432`	DYW_deaminase	24	116	2.3e-45	153.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUW3`	Arabidopsis thaliana	sp\|Q9ZUW3\|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610	69.200%	Swiss-Prot	High
`Q9FXB9`	Arabidopsis thaliana	sp\|Q9FXB9\|PPR84_ARATH Pentatricopeptide repeat-containing protein At1g56690, mitochondrial	69.100%	Swiss-Prot	High
`P0C7R1`	Arabidopsis thaliana	sp\|P0C7R1\|PPR74_ARATH Pentatricopeptide repeat-containing protein DWY1, chloroplastic	64.200%	Swiss-Prot	High
`Q9SUH6`	Arabidopsis thaliana	sp\|Q9SUH6\|PP341_ARATH Pentatricopeptide repeat-containing protein At4g30700	66.700%	Swiss-Prot	High
`O81767`	Arabidopsis thaliana	sp\|O81767\|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990	60.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card