TkAUNG000980 | RubberDandelionOmics

Gene overview

TkAUNG000980

Reference: TK1151 Chr: ChrUn Coordinates: 230574-231807 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkAUNG000980|TK1151|cDNA

ATGGATGTTGCCTCGTTGGATATGCTTCAGTTTCATTGGTGGGATTATTCTAATCTTGGCTACCTTGATGCGCTTAAACACCTTACAGATCTGAAAGAAGAAGGTGCAAAATTCAATTGTGACATGCGCCCTCAACAGAGGATGTATGGCACTCTGATGGGCGGACTATTATCCGAAAAGTTTCTTGATACCAACTTAACAATCCCTTTTGCTGGTCCTCCATTAAACACTCCTTCACTGCAAAAGTACAAAAGGATGGT...

CDS

Download CDS FASTA

399 bp · TkAUNG000980|TK1151|CDS

ATGGATGTTGCCTCGTTGGATATGCTTCAGTTTCATTGGTGGGATTATTCTAATCTTGGCTACCTTGATGCGCTTAAACACCTTACAGATCTGAAAGAAGAAGGTGCAAAATTCAATTGTGACATGCGCCCTCAACAGAGGATGTATGGCACTCTGATGGGCGGACTATTATCCGAAAAGTTTCTTGATACCAACTTAACAATCCCTTTTGCTGGTCCTCCATTAAACACTCCTTCACTGCAAAAGTACAAAAGGATGGT...

Protein

Download Protein FASTA

132 aa · TkAUNG000980|TK1151|PROTEIN

MDVASLDMLQFHWWDYSNLGYLDALKHLTDLKEEGAKFNCDMRPQQRMYGTLMGGLLSEKFLDTNLTIPFAGPPLNTPSLQKYKRMVDAWGGWSLFQVLLQTLKRVASKHGVSIPTVAVRYILDSKLLQGRW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG000980`
TK1151 ID	TkAUNG000980
OH-1004 ID	LXL04_013151
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	62.400
Protein coverage (%)	TK1151 98.485 / OH-1004 42.402 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG000980`
Location	ChrUn:230574-231807 (-)
Description	Similar to At1g06690: Uncharacterized oxidoreductase At1g06690, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013151` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009443 pyridoxal 5'-phosphate salvage Biological Process GO:0042820 vitamin B6 catabolic process Biological Process GO:0042821 pyridoxal biosynthetic process Biological Process GO:0071805 potassium ion transmembrane transport Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009536 plastid Cellular Component GO:0009941 chloroplast envelope Cellular Component
KEGG gene cross-reference	ath:AT1G06690 ath:AT5G53580 cre:CHLRE_12g544000v5 spo:2543325 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.474

Rank 1 · TkAUNG000980 · TK1151

Nucleus0.265

Rank 2 · TkAUNG000980 · TK1151

Peroxisome0.121

Rank 3 · TkAUNG000980 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkAUNG000980 · TK1151

Mitochondrion0.093

Rank 5 · TkAUNG000980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red1-35 aa

PF21027Sde0182_C7-87 aa

PF00248Aldo_ket_red49-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG000980	`PF00248`	Aldo_ket_red	1	35	3.4e-14	53.3
TkAUNG000980	`PF21027`	Sde0182_C	7	87	0.1	13.9
TkAUNG000980	`PF00248`	Aldo_ket_red	49	125	3.4e-14	53.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card