TkA08G415920 | RubberDandelionOmics

Gene overview

TkA08G415920

Reference: TK1151 Chr: Chr08 Coordinates: 105791707-105792534 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · TkA08G415920|TK1151|cDNA

ATGTTATGGAAGAAAGCAAGAGTGAAGAAAACAGGAGAGTATGACCCGCTTGTCCAAATTGTTGTTGATAAAATTAATAGACAAATTAATGGTGAGCCCGCACAAATGACATCCGGGACAAATGATATTCTTACACAGGCTCTAGGTACTGAGGAACACCGTGGGCATGTGCGTGAGATGGGAAAATATATCAGCCCGAACCAATATTTCTATTTACCCAAGACTGTGAAGGCGTACATGGACAAAGAGAATAAGAAGTT...

CDS

Download CDS FASTA

612 bp · TkA08G415920|TK1151|CDS

ATGTTATGGAAGAAAGCAAGAGTGAAGAAAACAGGAGAGTATGACCCGCTTGTCCAAATTGTTGTTGATAAAATTAATAGACAAATTAATGGTGAGCCCGCACAAATGACATCCGGGACAAATGATATTCTTACACAGGCTCTAGGTACTGAGGAACACCGTGGGCATGTGCGTGAGATGGGAAAATATATCAGCCCGAACCAATATTTCTATTTACCCAAGACTGTGAAGGCGTACATGGACAAAGAGAATAAGAAGTT...

Protein

Download Protein FASTA

203 aa · TkA08G415920|TK1151|PROTEIN

MLWKKARVKKTGEYDPLVQIVVDKINRQINGEPAQMTSGTNDILTQALGTEEHRGHVREMGKYISPNQYFYLPKTVKAYMDKENKKFDQRFNKLEGDVEKIQRTLNNASESASCQMWDKEDFEDVPHEELPDKSCFLAVNSVSNIVAKGTIMKYHLLVANSEVLLETCVQEKAFLPIPLEDVFIIKVKDAVGYILSWPTDLVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G415920`
TK1151 ID	TkA08G415920
OH-1004 ID	LXL04_008832
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 100.000 / OH-1004 17.483 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G415920`
Location	Chr08:105791707-105792534 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008832` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · TkA08G415920 · TK1151

Cytoplasm0.257

Rank 2 · TkA08G415920 · TK1151

Extracellular0.022

Rank 3 · TkA08G415920 · TK1151

Mitochondrion0.021

Rank 4 · TkA08G415920 · TK1151

Cell membrane0.018

Rank 5 · TkA08G415920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07532Big_464-86 aa

PF28217FAM81B72-118 aa

PF08702Fib_alpha76-111 aa

PF04871Uso1_p115_C81-124 aa

PF10458Val_tRNA-synt_C81-108 aa

PF28520PRR11_2nd89-107 aa

PF26133DUF8039134-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G415920	`PF07532`	Big_4	64	86	0.061	13.6
TkA08G415920	`PF28217`	FAM81B	72	118	0.19	11.6
TkA08G415920	`PF08702`	Fib_alpha	76	111	0.11	13.3
TkA08G415920	`PF04871`	Uso1_p115_C	81	124	0.028	15.4
TkA08G415920	`PF10458`	Val_tRNA-synt_C	81	108	0.12	13.4
TkA08G415920	`PF28520`	PRR11_2nd	89	107	0.11	13.2
TkA08G415920	`PF26133`	DUF8039	134	202	0.042	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card