TkA08G408860 | RubberDandelionOmics

Gene overview

TkA08G408860

Reference: TK1151 Chr: Chr08 Coordinates: 104065485-104066300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA08G408860|TK1151|cDNA

TTTCTGCAATCGATTTTTCACGTCCTTGCAGCTCTCGACGGCGTCGTCACTATTGTTGCTCTGGTACAATTAATTAGGATTCAGCTAAGAGTTCCCGAGTATGGTTGGACCACCCAGAAAGTCTTCCATTTCCTCAATGTCTTTGTCAATGGAGTTAGATGTTTAATCTTTTTGTTCCACCGAGATGTTCAACAATTAAAGCCAAAGATTGTTCAACATATATTGCTTGATGTCCCAAAAAGTTTTATTTTTACAAATTG...

CDS

Download CDS FASTA

309 bp · TkA08G408860|TK1151|CDS

TTTCTGCAATCGATTTTTCACGTCCTTGCAGCTCTCGACGGCGTCGTCACTATTGTTGCTCTGGTACAATTAATTAGGATTCAGCTAAGAGTTCCCGAGTATGGTTGGACCACCCAGAAAGTCTTCCATTTCCTCAATGTCTTTGTCAATGGAGTTAGATGTTTAATCTTTTTGTTCCACCGAGATGTTCAACAATTAAAGCCAAAGATTGTTCAACATATATTGCTTGATGTCCCAAAAAGTTTTATTTTTACAAATTG...

Protein

Download Protein FASTA

102 aa · TkA08G408860|TK1151|PROTEIN

FLQSIFHVLAALDGVVTIVALVQLIRIQLRVPEYGWTTQKVFHFLNVFVNGVRCLIFLFHRDVQQLKPKIVQHILLDVPKSFIFTNWSLCKVLVMFLVPGWS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G408860`
TK1151 ID	TkA08G408860
OH-1004 ID	LXL04_008512
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 49.754 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G408860

Location Chr08:104065485-104066300 (-)

Description Similar to TOM3: Tobamovirus multiplication protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14530`	Contributes to the intracellular multiplication of tobamoviruses, probably being a membrane anchor promoting the formation of the replication complex.	Involvement of THH1, an Arabidopsis thaliana homologue of the TOM1 gene, in tobamovirus multiplication.2006 · DOI: 10.1099/vir.0.81942-0
`At2g02180`	Contributes to the intracellular multiplication of tobamoviruses, probably being a membrane anchor promoting the formation of the replication complex.	Complete inhibition of tobamovirus multiplication by simultaneous mutations in two homologous host genes.2002 · DOI: 10.1128/jvi.76.5.2491-2497.2002
`At4g21790`	Necessary for the efficient intracellular multiplication of tobamoviruses, probably being a membrane anchor promoting the formation of the replication complex.	TOM1, an Arabidopsis gene required for efficient multiplication of a tobamovirus, encodes a putative transmembrane protein.2000 · DOI: 10.1073/pnas.170295097 Effects of the tom1 mutation of Arabidopsis thaliana on the multiplication of tobacco mosaic virus RNA in protoplasts.1993 · DOI: 10.1128/jvi.67.9.5328-5338.1993

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008512 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046786 viral replication complex formation and maintenance Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0046790 virion binding Molecular Function

KEGG gene cross-reference

ath:AT1G14530

ath:AT2G02180

ath:AT4G21790

nta:107769903

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.384

Rank 1 · TkA08G408860 · TK1151

Golgi apparatus0.225

Rank 2 · TkA08G408860 · TK1151

Cytoplasm0.204

Rank 3 · TkA08G408860 · TK1151

Cell membrane0.187

Rank 4 · TkA08G408860 · TK1151

Lysosome / Vacuole0.119

Rank 5 · TkA08G408860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06454THH1_TOM1-3_dom3-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G408860	`PF06454`	THH1_TOM1-3_dom	3	96	7.1e-34	118.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q948R8`	Arabidopsis thaliana	sp\|Q948R8\|THH1_ARATH Protein TOM THREE HOMOLOG 1	65.500%	Swiss-Prot	High
`Q9ZUM2`	Arabidopsis thaliana	sp\|Q9ZUM2\|TOM3_ARATH Tobamovirus multiplication protein 3	64.400%	Swiss-Prot	High
`Q9FEG2`	Arabidopsis thaliana	sp\|Q9FEG2\|TOM1_ARATH Tobamovirus multiplication protein 1	52.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card