TkA08G408020 | RubberDandelionOmics

Gene overview

TkA08G408020

Reference: TK1151 Chr: Chr08 Coordinates: 103882498-103885173 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA08G408020|TK1151|cDNA

ATGGGCAAGTCGACGGCGACGACGAAAGATGATGCGCAATCTCTTTTCCGCTCTCTGCATTCTGCTTATTCAGCTACTCCCACTAATCTCAAGATCATAGATCTGTACGTGGTGTTTGCCGTCTTCACTGCTCTGATCCAGCATGCTATCAGTTACATGGCCATTGTTGGTTCCTTTTCATTCAACTCCTTTCTCTCGGGTGTACTTTCTTGTGTAGGAACAGCTGTTCTTGCAGGTAATCTTATGCATACACAACATTA...

CDS

Download CDS FASTA

348 bp · TkA08G408020|TK1151|CDS

ATGGGCAAGTCGACGGCGACGACGAAAGATGATGCGCAATCTCTTTTCCGCTCTCTGCATTCTGCTTATTCAGCTACTCCCACTAATCTCAAGATCATAGATCTGTACGTGGTGTTTGCCGTCTTCACTGCTCTGATCCAGCATGCTATCAGTTACATGGCCATTGTTGGTTCCTTTTCATTCAACTCCTTTCTCTCGGGTGTACTTTCTTGTGTAGGAACAGCTGTTCTTGCAGGTAATCTTATGCATACACAACATTA...

Protein

Download Protein FASTA

115 aa · TkA08G408020|TK1151|PROTEIN

MGKSTATTKDDAQSLFRSLHSAYSATPTNLKIIDLYVVFAVFTALIQHAISYMAIVGSFSFNSFLSGVLSCVGTAVLAGNLMHTQHYAWIQCSMAVGMVKRGSVSGRNGRTLCHR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G408020`
TK1151 ID	TkA08G408020
OH-1004 ID	LXL04_026117
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.300
Protein coverage (%)	TK1151 67.826 / OH-1004 64.407 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G408020

Location Chr08:103882498-103885173 (+)

Description Similar to DAD1: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32210`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release
`At2g35520`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026117 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0043069 negative regulation of programmed cell death Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0008250 oligosaccharyltransferase complex Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32210

ath:AT2G35520

sly:543753

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.740

Rank 1 · TkA08G408020 · TK1151

Nucleus0.154

Rank 2 · TkA08G408020 · TK1151

Cytoplasm0.107

Rank 3 · TkA08G408020 · TK1151

Golgi apparatus0.089

Rank 4 · TkA08G408020 · TK1151

Cell membrane0.055

Rank 5 · TkA08G408020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02109DAD13-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G408020	`PF02109`	DAD	13	81	1.5e-15	58.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39080`	Arabidopsis thaliana	sp\|Q39080\|DAD1_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1	84.500%	Swiss-Prot	Medium
`O22622`	Arabidopsis thaliana	sp\|O22622\|DAD2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD2	81.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card