Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1667 bp · TkA08G407580|TK1151|cDNA
CCGAAGGCTTCACTAGAGCATTCCTCTTTCAAAAAATGGCCACTCATAATACTACCGAGAAAGAAAACTGCAAACTCGTTATCGATCATGCACTACGTCCTTTTGTCAATTTCCCTCCATCTATTTGGGGTGATCGTTTAATGGCACTATCTGTCGATCCTTCTGAGTTGCATGATTATTCTACTGTCATGGAAAAGCCAAAACAAGAGCTGAGACGATTGATAACCAATCCACAAATGGATTCAAATGAAAAACTACGA...
1632 bp · TkA08G407580|TK1151|CDS
ATGGCCACTCATAATACTACCGAGAAAGAAAACTGCAAACTCGTTATCGATCATGCACTACGTCCTTTTGTCAATTTCCCTCCATCTATTTGGGGTGATCGTTTAATGGCACTATCTGTCGATCCTTCTGAGTTGCATGATTATTCTACTGTCATGGAAAAGCCAAAACAAGAGCTGAGACGATTGATAACCAATCCACAAATGGATTCAAATGAAAAACTACGATTGATTAATTCTGTGTATCGCCTTGGTTTAAGATA...
Protein
Download Protein FASTA544 aa · TkA08G407580|TK1151|PROTEIN
MATHNTTEKENCKLVIDHALRPFVNFPPSIWGDRLMALSVDPSELHDYSTVMEKPKQELRRLITNPQMDSNEKLRLINSVYRLGLRYLFGEEIECQLDKLFKELKMDYYDEADLYTVSINFQVFRQHGYKLSCDVFNKFKDHSSGKFKEYIKSDVRGMLSLYEATQLSIKGESILDEAMAFTEAQLMDVVDTLEGSLGEQVKHALRSPSHRGMQMVETRLYFSNYEEECSRYDSLLKLANAHFNYLQLLHREELTTFIKW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G407580 |
|---|---|
| TK1151 ID | TkA08G407580 |
| OH-1004 ID | LXL04_034492 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 88.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 97.608Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G407580 |
|---|---|
| Location | Chr08:103764197-103767597 (+) |
| Description | Similar to Germacrene A synthase short form |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0016102 diterpenoid biosynthetic process Biological Process GO:0045338 farnesyl diphosphate metabolic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0000287 magnesium ion binding Molecular Function GO:0010334 sesquiterpene synthase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0034005 germacrene-A synthase activity Molecular Function |
| KEGG gene cross-reference | ag:AAM21659 ag:AMQ26035 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01397Terpene_synth31-205 aaPF30351GPG151-105 aaPF30351GPG1182-209 aaPF03936Terpene_synth_C262-501 aaPF19086Terpene_syn_C_2302-501 aaPF30351GPG1319-353 aaPF30351GPG1434-469 aaPF01397Terpene_synth468-501 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G407580 | PF01397 | Terpene_synth | 31 | 205 | 8.3e-47 | 160.1 |
| TkA08G407580 | PF30351 | GPG1 | 51 | 105 | 0.15 | 12.7 |
| TkA08G407580 | PF30351 | GPG1 | 182 | 209 | 0.15 | 12.7 |
| TkA08G407580 | PF03936 | Terpene_synth_C | 262 | 501 | 8.4e-82 | 274.8 |
| TkA08G407580 | PF19086 | Terpene_syn_C_2 | 302 | 501 | 2.4e-47 | 162.0 |
| TkA08G407580 | PF30351 | GPG1 | 319 | 353 | 0.15 | 12.7 |
| TkA08G407580 | PF30351 | GPG1 | 434 | 469 | 0.15 | 12.7 |
| TkA08G407580 | PF01397 | Terpene_synth | 468 | 501 | 8.3e-47 | 160.1 |
| TkA08G407580 | PF30351 | GPG1 | 509 | 535 | 0.15 | 12.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.