TkA08G406780 | RubberDandelionOmics

Gene overview

TkA08G406780

Reference: TK1151 Chr: Chr08 Coordinates: 103513685-103516907 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA08G406780|TK1151|cDNA

ATGAACCACAATGAATTTCATGTAGTTGATATGGAACCACTTTCGAAAACACACAAACCAAAATTCGTGTGGAATAATCAGACATTGCTTAAGTTTCTAGATTTGTGTGTGAGTGAAATGAGAAAGGGAAATAGACCCGGTACTTACTTCACTAAGGCTGGGTGGTCGAATTTGTTAAATGATATGACGGCATACACTGGCAAAACCTTTACTATAAAACAAGTAAAAAACAAATGGGAAAACATGAAAAAAGAGTGGAA...

CDS

Download CDS FASTA

429 bp · TkA08G406780|TK1151|CDS

ATGAACCACAATGAATTTCATGTAGTTGATATGGAACCACTTTCGAAAACACACAAACCAAAATTCGTGTGGAATAATCAGACATTGCTTAAGTTTCTAGATTTGTGTGTGAGTGAAATGAGAAAGGGAAATAGACCCGGTACTTACTTCACTAAGGCTGGGTGGTCGAATTTGTTAAATGATATGACGGCATACACTGGCAAAACCTTTACTATAAAACAAGTAAAAAACAAATGGGAAAACATGAAAAAAGAGTGGAA...

Protein

Download Protein FASTA

142 aa · TkA08G406780|TK1151|PROTEIN

MNHNEFHVVDMEPLSKTHKPKFVWNNQTLLKFLDLCVSEMRKGNRPGTYFTKAGWSNLLNDMTAYTGKTFTIKQVKNKWENMKKEWKLYDRLMRLETGIGGTRSLIDASPECWAEKINENKDFAKFKDTDLSIYESHYAPLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G406780`
TK1151 ID	TkA08G406780
OH-1004 ID	LXL04_000960
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 20.028 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G406780

Location Chr08:103513685-103516907 (+)

Description Similar to LIMYB: L10-interacting MYB domain-containing protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05800`	Transcriptional repressor that associates with ribosomal protein promoters.	NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000960 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G05800

rno:690164

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.920

Rank 1 · TkA08G406780 · TK1151

Cytoplasm0.159

Rank 2 · TkA08G406780 · TK1151

Mitochondrion0.021

Rank 3 · TkA08G406780 · TK1151

Extracellular0.018

Rank 4 · TkA08G406780 · TK1151

Cell membrane0.017

Rank 5 · TkA08G406780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12776Myb_DNA-bind_324-114 aa

PF13837Myb_DNA-bind_424-88 aa

PF07796DUF163842-109 aa

PF13873Myb_DNA-bind_555-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G406780	`PF12776`	Myb_DNA-bind_3	24	114	1.6e-15	58.6
TkA08G406780	`PF13837`	Myb_DNA-bind_4	24	88	0.0011	20.0
TkA08G406780	`PF07796`	DUF1638	42	109	0.0076	16.9
TkA08G406780	`PF13873`	Myb_DNA-bind_5	55	87	0.0013	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFJ8`	Arabidopsis thaliana	sp\|Q9FFJ8\|LIMYB_ARATH L10-interacting MYB domain-containing protein	34.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card