TkA08G393400 | RubberDandelionOmics

Gene overview

TkA08G393400

Reference: TK1151 Chr: Chr08 Coordinates: 100294095-100309102 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

1497 bp · TkA08G393400|TK1151|CDS

ATGTTTGAAAGCCTAATTGCGAGCTTCTCGGGTCCATCATCCAGTGAACCTGAAAAGTCAATGGAAGCTTCCGGAATAGTGTTAGTGGCGGGTGCCACCGGTGGTGTTGGGAGAAGAGTGGTTGATGTCTTACGGAACAAAGGGTTGCCCGTTAGAGTATTGGTAAGAAATAAAGAAAAAGCAGAGAAAATGCTAGGCCCAGATATTGACATGGTGGTTGGAGATATCACTAAAGCAAGTACTCTACTTCCTGATTACTT...

Protein

Download Protein FASTA

498 aa · TkA08G393400|TK1151|PROTEIN

MFESLIASFSGPSSSEPEKSMEASGIVLVAGATGGVGRRVVDVLRNKGLPVRVLVRNKEKAEKMLGPDIDMVVGDITKASTLLPDYFKGVTKVINAVSVIVGPKEGDTPDRAKYNQGIKFFEPEIKGDSPEMVEYIGMQNLIKALKDNVGLKSGKLVYGFEDGSSRNLPWGALDDVVMGGVSESSFMEVPNGSETGGPTGLFKGIVSTTNNGGFTSIRTKNFDVAENLCAYDGLELRVKGDGRRYKLIVRTSRDWDTVGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G393400`
TK1151 ID	TkA08G393400
OH-1004 ID	LXL04_034446
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 85.789 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G393400`
Location	Chr08:100294095-100309102 (-)
Description	Similar to HCF173: Protein HIGH CHLOROPHYLL FLUORESCENCE PHENOTYPE 173, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034446` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process GO:0006413 translational initiation Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010207 photosystem II assembly Biological Process GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009523 photosystem II Cellular Component
KEGG gene cross-reference	ath:AT1G16720 ath:AT1G17350 ath:AT2G34460 ath:AT5G02240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.640

Rank 1 · TkA08G393400 · TK1151

Mitochondrion0.276

Rank 2 · TkA08G393400 · TK1151

Cytoplasm0.151

Rank 3 · TkA08G393400 · TK1151

Nucleus0.052

Rank 4 · TkA08G393400 · TK1151

Endoplasmic reticulum0.052

Rank 5 · TkA08G393400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08659KR25-54 aa

PF05368NmrA26-98 aa

PF00106adh_short26-97 aa

PF01370Epimerase27-100 aa

PF02254TrkA_N28-83 aa

PF13460NAD_binding_1031-145 aa

PF08547CIA30168-330 aa

PF13460NAD_binding_10343-442 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G393400	`PF08659`	KR	25	54	0.3	11.7
TkA08G393400	`PF05368`	NmrA	26	98	8.1e-09	36.2
TkA08G393400	`PF00106`	adh_short	26	97	0.00068	19.9
TkA08G393400	`PF01370`	Epimerase	27	100	4.6e-07	30.2
TkA08G393400	`PF02254`	TrkA_N	28	83	0.003	18.6
TkA08G393400	`PF13460`	NAD_binding_10	31	145	5.7e-27	95.5
TkA08G393400	`PF08547`	CIA30	168	330	3e-39	135.3
TkA08G393400	`PF13460`	NAD_binding_10	343	442	5.7e-27	95.5
TkA08G393400	`PF05368`	NmrA	383	400	8.1e-09	36.2
TkA08G393400	`PF01370`	Epimerase	389	404	4.6e-07	30.2
TkA08G393400	`PF01370`	Epimerase	436	463	4.6e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card