TkA08G384900 | RubberDandelionOmics

Gene overview

TkA08G384900

Reference: TK1151 Chr: Chr08 Coordinates: 98319344-98322987 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2409 bp · TkA08G384900|TK1151|cDNA

CGGCGGTTCCAGAACTGGAACTGGTTTGACCGGGTCCGGTTCCAAATCCAAAAAGGAGGTTTCTCTCTCATTTCCTATCACCATTTTTAATTATTCATACTGCAACTGTGATTTAACTCAAGCTTCACATCGTCGATGGAAAGAAAATTAGTATGTGATAGTTTCTGTGAAACAAGAGCATACTCCCGAGTGTATTTTGTCAAGCTATTTTACGGCAGTTGAATCTCAGCTAAGCCAATACGGGATAACGAAGGGTTCCA...

CDS

Download CDS FASTA

1488 bp · TkA08G384900|TK1151|CDS

ATGGAAATCATATCCGGTCATTCAACGCCTTGTTGTCGTCTCGCAACTCTAAGCCATTATTTTCCCGAGAAACCCTTAAATTCAGTCCCTTCAAACTTCTCAAAAAGAAGAAAACATAAATTCGTCGATAGTTCTTTTCCATCTAGCGTTCGCCTAAACAATTACAATACGGTTCATAAGTCTACCCCATTATACGCTCTTAAAGGTGTTGAAGGTGTTATCGGTGGAGAAGAAACCCTAGAAAACGTGACCAAAAGAAG...

Protein

Download Protein FASTA

495 aa · TkA08G384900|TK1151|PROTEIN

MEIISGHSTPCCRLATLSHYFPEKPLNSVPSNFSKRRKHKFVDSSFPSSVRLNNYNTVHKSTPLYALKGVEGVIGGEETLENVTKRRQSIPKVLIPGLPDDSKGDVSAHVSTGEWEWKPKFKIHYERSGSRNIDSPQILFLPGFGVGSFHYEKQLKDLGQDFGVWAMDFLGQGMSLPCEDPTLQLPNNGYSEMWGLGDETEPWADDLVYSIDLWQEQVRYFIQEVIKEPVYIVGNSLGGYVALYIAACNPNLVKGVTLLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G384900`
TK1151 ID	TkA08G384900
OH-1004 ID	LXL04_007780
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	27.000
Protein coverage (%)	TK1151 64.242 / OH-1004 57.422 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G384900

Location Chr08:98319344-98322987 (+)

Description Similar to PPH: Pheophytinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13800`	Alpha/beta hydrolase dephytylating specifically the Mg-free chlorophyll pigment (pheophytin), yielding pheophorbide.	Reverse genetic identification of CRN1 and its distinctive role in chlorophyll degradation in Arabidopsis.2010 · DOI: 10.1111/j.1744-7909.2010.00945.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007780 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0015996 chlorophyll catabolic process Biological Process

GO:0042203 toluene catabolic process Biological Process

GO:0043640 benzoate catabolic process via hydroxylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004301 epoxide hydrolase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0018765 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase activity Molecular Function

KEGG gene cross-reference

ag:CAA36993

ath:AT5G13800

bsu:BSU31420

cel:CELE_K07C5.5

ppf:Pput_2882

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · TkA08G384900 · TK1151

Mitochondrion0.028

Rank 2 · TkA08G384900 · TK1151

Nucleus0.021

Rank 3 · TkA08G384900 · TK1151

Cytoplasm0.020

Rank 4 · TkA08G384900 · TK1151

Cell membrane0.014

Rank 5 · TkA08G384900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12697Abhydrolase_6138-418 aa

PF00561Abhydrolase_1138-413 aa

PF12146Hydrolase_4138-261 aa

PF10230LIDHydrolase211-403 aa

PF20408Abhydrolase_11213-259 aa

PF02230Abhydrolase_2215-261 aa

PF05728UPF0227216-248 aa

PF11144DUF2920227-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G384900	`PF12697`	Abhydrolase_6	138	418	9.5e-19	69.6
TkA08G384900	`PF00561`	Abhydrolase_1	138	413	3.1e-17	63.8
TkA08G384900	`PF12146`	Hydrolase_4	138	261	6.4e-07	29.7
TkA08G384900	`PF10230`	LIDHydrolase	211	403	0.00024	21.6
TkA08G384900	`PF20408`	Abhydrolase_11	213	259	0.09	13.2
TkA08G384900	`PF02230`	Abhydrolase_2	215	261	0.0075	16.8
TkA08G384900	`PF05728`	UPF0227	216	248	0.0083	16.8
TkA08G384900	`PF11144`	DUF2920	227	256	0.12	12.2
TkA08G384900	`PF00756`	Esterase	230	266	0.00087	19.8
TkA08G384900	`PF02230`	Abhydrolase_2	357	391	0.0075	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFZ1`	Arabidopsis thaliana	sp\|Q9FFZ1\|PPH_ARATH Pheophytinase, chloroplastic	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card