Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2556 bp · TkA08G382600|TK1151|cDNA
CTAAAACAAACCTGGCGCCAATTCCTTCCCGCCGCCCCTTCCCCCTAAAAAAACCCTACACACTCCAAAACATCGGCAGGAGCGGGAACATTTGGCTAACCTAATCAAATTCGAGCGCTGAATCTCTATGAAAACTTCAATTTATTCCGATTTCAATGGAGATGCAATCAATCACGCCTAAATCGCGATTCCAAACGTTGCCATCTTGAATCAACCAATCAAGCCTAACTTGTGATTTTTGAGTCTTGGCTTTGAGCGAC...
1830 bp · TkA08G382600|TK1151|CDS
ATGTTCTACTCGCACAATCTACTTGCAAGAAAAGGTCCATTAGGCACAGTGTGGTGCGCCGCACATCTACAAAACAAGCTCAAGAAATCAAACTATATCACCGTCAATATCCCATCGACTGTTGAGCAAATAATGAATCCGCAAGTTCCAATTGCATTGAGAATGTCTGGTCATCTACTGCTTGGTGTTGTTCGGATATATTCAAAGAAAGTGGAGTATCTCCAGCATGACTACAATGTCCTACGTATAGACATAAGCAA...
Protein
Download Protein FASTA609 aa · TkA08G382600|TK1151|PROTEIN
MFYSHNLLARKGPLGTVWCAAHLQNKLKKSNYITVNIPSTVEQIMNPQVPIALRMSGHLLLGVVRIYSKKVEYLQHDYNVLRIDISKVYTNTDINLPKDANQAHFDSITLPERFDLDLMDVDDYDPLGSPDTHLRPHEDITLLESRDKIPSGYFMISFGEDTFSNPSLSGQESPCPRTPMSGPSQHMSPVFNDNNNTVSPEMQRDAIHISPHGHIVFPEMVDPDPELVHQISSQKDIPAVADSPIIDVSDLPPQHTPPHH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G382600 |
|---|---|
| TK1151 ID | TkA08G382600 |
| OH-1004 ID | LXL04_034223 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 91.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 91.509Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G382600 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:97735183-97739365 (-) | |||||||||
| Description | Similar to SYN3: Sister chromatid cohesion 1 protein 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000278 mitotic cell cycle Biological Process GO:0006302 double-strand break repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007059 chromosome segregation Biological Process GO:0007062 sister chromatid cohesion Biological Process GO:0007064 mitotic sister chromatid cohesion Biological Process GO:0008015 blood circulation Biological Process GO:0009555 pollen development Biological Process GO:0009561 megagametogenesis Biological Process GO:0051301 cell division Biological Process GO:0070601 centromeric sister chromatid cohesion Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G59550 ath:AT5G16270 dre:322275 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04825Rad21_Rec8_N1-101 aaPF06278CNDH2_N59-75 aaPF04824Rad21_Rec8549-601 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G382600 | PF04825 | Rad21_Rec8_N | 1 | 101 | 3.8e-36 | 124.3 |
| TkA08G382600 | PF06278 | CNDH2_N | 59 | 75 | 0.25 | 12.1 |
| TkA08G382600 | PF04824 | Rad21_Rec8 | 549 | 601 | 1e-18 | 67.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.