Gene Card
Gene overview
cDNA / CDS / Protein Sequences
420 bp · TkA08G376200|TK1151|cDNA
TCAACTGGAACCACCACCGACCACCGTACCGCCGCCGCCGGTGACGCCGGAAAAACGCGAAAGTTCTCCGATCGTCCCAAACTTCTACCACGTATTCCCCATACAGCCACGACACAACCTCATACATTTTTGTCCGAAAAACACCGCCGGAAAACACCCCAAATCGGCGCCGGCATCGCCGATTGTCGCGGAACCGCCGCCGCCCTCAAAGCCGTCGAATTCGGCCACCTCTGTCGGATCCAAGCACACCGATCGACTCC...
420 bp · TkA08G376200|TK1151|CDS
TCAACTGGAACCACCACCGACCACCGTACCGCCGCCGCCGGTGACGCCGGAAAAACGCGAAAGTTCTCCGATCGTCCCAAACTTCTACCACGTATTCCCCATACAGCCACGACACAACCTCATACATTTTTGTCCGAAAAACACCGCCGGAAAACACCCCAAATCGGCGCCGGCATCGCCGATTGTCGCGGAACCGCCGCCGCCCTCAAAGCCGTCGAATTCGGCCACCTCTGTCGGATCCAAGCACACCGATCGACTCC...
Protein
Download Protein FASTA139 aa · TkA08G376200|TK1151|PROTEIN
STGTTTDHRTAAAGDAGKTRKFSDRPKLLPRIPHTATTQPHTFLSEKHRRKTPQIGAGIADCRGTAAALKAVEFGHLCRIQAHRSTPLTPATTPRPETGRMWGWTTGIFSSFNYSSAVFTIHPAVFTIHSAAFLQQSLV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G376200 |
|---|---|
| TK1151 ID | TkA08G376200 |
| OH-1004 ID | LXL04_035538 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 71.000 |
| Protein coverage (%) | TK1151 71.223 / OH-1004 12.468Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G376200 |
|---|---|
| Location | Chr08:96205354-96205773 (+) |
| Description | Similar to PYD1: Dihydropyrimidine dehydrogenase (NADP(+)), chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006145 purine nucleobase catabolic process Biological Process GO:0006208 pyrimidine nucleobase catabolic process Biological Process GO:0006210 thymine catabolic process Biological Process GO:0006212 uracil catabolic process Biological Process GO:0006214 thymidine catabolic process Biological Process GO:0006248 CMP catabolic process Biological Process GO:0006249 dCMP catabolic process Biological Process GO:0007584 response to nutrient Biological Process GO:0007623 circadian rhythm Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0019483 beta-alanine biosynthetic process Biological Process GO:0019860 uracil metabolic process Biological Process |
| KEGG gene cross-reference | ath:AT3G17810 ece:Z3402 ecj:JW2134 eco:b2147 ecoc:C3026_12030 ecs:ECs_3039 mmu:99586 stm:STM2187 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.