TkA08G362340 | RubberDandelionOmics

Gene overview

TkA08G362340

Reference: TK1151 Chr: Chr08 Coordinates: 92844196-92845572 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1278 bp · TkA08G362340|TK1151|cDNA

ATGATGATGAAAAAGCTCTTTAGACATGGCAGAAGACAGCTTCACACGATTATCTCCAGAGAGATCATCAAACCCTCTTCTCCAACCCCTTCTCACCTGAAAACATACAATCTTTCTTTGTTTGATCAACTTGCTGTAAATACACATATGCCAGTTGTAGCATTCTACCCTTCCTCCACTATTTATCAAAGCCCTCATGATAAAACCCTCGACCTGAAAAACTCCATATCACAAACCTTAACTCAGTACTATCCATATGC...

CDS

Download CDS FASTA

1278 bp · TkA08G362340|TK1151|CDS

ATGATGATGAAAAAGCTCTTTAGACATGGCAGAAGACAGCTTCACACGATTATCTCCAGAGAGATCATCAAACCCTCTTCTCCAACCCCTTCTCACCTGAAAACATACAATCTTTCTTTGTTTGATCAACTTGCTGTAAATACACATATGCCAGTTGTAGCATTCTACCCTTCCTCCACTATTTATCAAAGCCCTCATGATAAAACCCTCGACCTGAAAAACTCCATATCACAAACCTTAACTCAGTACTATCCATATGC...

Protein

Download Protein FASTA

425 aa · TkA08G362340|TK1151|PROTEIN

MMMKKLFRHGRRQLHTIISREIIKPSSPTPSHLKTYNLSLFDQLAVNTHMPVVAFYPSSTIYQSPHDKTLDLKNSISQTLTQYYPYAGKLAKIHPTYIDCNDDGVEFIEATNDGSLSDFLQRSVHEDFDQLFPNAINDEIETTTTTPLFVQVNHFSCGGVAVAASLTHRIGDASSLLNFFNHWATETRSHVILPKNIPDRSQGDDLVTRSFVFPNSKINEFKSKISSMMRSESGDPIMNPTRAEALTWLIHKCAVSAASK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G362340`
TK1151 ID	TkA08G362340
OH-1004 ID	LXL04_005462
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	52.600
Protein coverage (%)	TK1151 97.176 / OH-1004 99.544 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G362340`
Location	Chr08:92844196-92845572 (-)
Description	Similar to ASAT3: Acylsugar acyltransferase 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005462` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005985 sucrose metabolic process Biological Process GO:0009821 alkaloid biosynthetic process Biological Process GO:0035835 indole alkaloid biosynthetic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016407 acetyltransferase activity Molecular Function GO:0016746 acyltransferase activity Molecular Function GO:0016755 aminoacyltransferase activity Molecular Function
KEGG gene cross-reference	ag:UQZ09626 ag:URS65387 sly:101268255 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.799

Rank 1 · TkA08G362340 · TK1151

Nucleus0.312

Rank 2 · TkA08G362340 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA08G362340 · TK1151

Cell membrane0.045

Rank 4 · TkA08G362340 · TK1151

Mitochondrion0.035

Rank 5 · TkA08G362340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase16-190 aa

PF02458Transferase200-420 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G362340	`PF02458`	Transferase	16	190	2.7e-67	228.0
TkA08G362340	`PF02458`	Transferase	200	420	2.7e-67	228.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card