TkA08G349240 | RubberDandelionOmics

Gene overview

TkA08G349240

Reference: TK1151 Chr: Chr08 Coordinates: 89499393-89502270 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · TkA08G349240|TK1151|cDNA

TTCCATATCACCAACCATTGTCTCAAACCTTTGTACGCATCCTTGTTCTAAATTCGTGGTGTGCTTCTTCGATTTCTCTTCATCATCGCGCAAAAAGTCTCGTTTTTTCAACCAGGTTATAGATTAGTAATACTACATGGATGAGACAAAAAAAAGTGACGATTTTACCTTTTGGCAGGTTAGTGATGAAAACAGATCTGAACAGAAAAGTCTTCCAGATGTTGGCAGTATGAGTATAGAAGAGAAAAAGAAGAGTAGTG...

CDS

Download CDS FASTA

645 bp · TkA08G349240|TK1151|CDS

ATGGATGAGACAAAAAAAAGTGACGATTTTACCTTTTGGCAGGTTAGTGATGAAAACAGATCTGAACAGAAAAGTCTTCCAGATGTTGGCAGTATGAGTATAGAAGAGAAAAAGAAGAGTAGTGGTACTATTTGGGGTGATAGTTCGAGAAGTAATGCTGATTTGGAGAAAAAGGAGAAAGTTGGATCGTTGACTTTTAAGGTTATCGATGCATCTTCGCAGAAAAAGTCAACGGAACCTTCCAAAGAAGCTGCGGAAAG...

Protein

Download Protein FASTA

214 aa · TkA08G349240|TK1151|PROTEIN

MDETKKSDDFTFWQVSDENRSEQKSLPDVGSMSIEEKKKSSGTIWGDSSRSNADLEKKEKVGSLTFKVIDASSQKKSTEPSKEAAESSQRPKSGAKKPASRAKVPFQIGYSHMDWLKVTRTHPDLAGLKGQSNKRLIPLSEVKQHQTADSMWTVLKGRVYNITPYMKFHPGGVDMLMKAVGKDCTALFNKYHAWVNAEFMLEKCLVGILEESRQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G349240`
TK1151 ID	TkA08G349240
OH-1004 ID	LXL04_025885
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.300
Protein coverage (%)	TK1151 33.178 / OH-1004 7.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G349240

Location Chr08:89499393-89502270 (-)

Description Similar to NIA: Nitrate reductase [NADH]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09680`	Involved in the control of lateral root (LR) formation.	RLF, a cytochrome b(5)-like heme/steroid binding domain protein, controls lateral root formation independently of ARF7/19-mediated auxin signaling in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04199.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025885 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006790 sulfur compound metabolic process Biological Process

GO:0006809 nitric oxide biosynthetic process Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0004128 cytochrome-b5 reductase activity, acting on NAD(P)H Molecular Function

GO:0008482 sulfite oxidase activity Molecular Function

GO:0009703 nitrate reductase (NADH) activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0030151 molybdenum ion binding Molecular Function

GO:0043546 molybdopterin cofactor binding Molecular Function

GO:0050464 nitrate reductase (NADPH) activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.571

Rank 1 · TkA08G349240 · TK1151

Nucleus0.374

Rank 2 · TkA08G349240 · TK1151

Endoplasmic reticulum0.102

Rank 3 · TkA08G349240 · TK1151

Cell membrane0.092

Rank 4 · TkA08G349240 · TK1151

Golgi apparatus0.088

Rank 5 · TkA08G349240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11200DUF298146-102 aa

PF00173Cyt-b5139-209 aa

PF22997CHS4148-194 aa

PF11200DUF2981184-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G349240	`PF11200`	DUF2981	46	102	0.82	9.8
TkA08G349240	`PF00173`	Cyt-b5	139	209	1.8e-24	86.2
TkA08G349240	`PF22997`	CHS4	148	194	0.03	15.3
TkA08G349240	`PF11200`	DUF2981	184	205	0.82	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXD1`	Arabidopsis thaliana	sp\|Q9LXD1\|RLF_ARATH Cytochrome b5 domain-containing protein RLF	57.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card