TkA08G345090 | RubberDandelionOmics

Gene overview

TkA08G345090

Reference: TK1151 Chr: Chr08 Coordinates: 88466894-88472945 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4849 bp · TkA08G345090|TK1151|cDNA

CTCACACTTTCAAATTCAAATTTGAAAACCCTCACACCCCCATGGATTTCTTTTACAATTGATTCCACCACCTGACCACCATTAAACCCAATTCCCCACCTCCACATCTCATATCTCCGCCGCTTTCTCTTTCAACAGACACCATCTCTGTGTCTCTCTAAACACGAACAACCATGGTCACAGAAAAGCGCCAACCACTCCAGTCGAGCACCACAGACAACATACCACCAGCCACCAAACCCGCCGCTACCAAAGCCGGG...

CDS

Download CDS FASTA

3804 bp · TkA08G345090|TK1151|CDS

ATGGTCACAGAAAAGCGCCAACCACTCCAGTCGAGCACCACAGACAACATACCACCAGCCACCAAACCCGCCGCTACCAAAGCCGGGAGAACCATCGAAGAAACTTATCAGAAGAAGACTCAGCTTGAGCACATCCTTCTCCGGCCCGATACTTACATTGGATCCATCGAAAAACATGAACAGACGCTTTGGGTATGGGAAGAAGAGAAAATGGTTAAAAGATGTATATCGTACGTCCCTGGTCTCTACAAGATCTTTGA...

Protein

Download Protein FASTA

1267 aa · TkA08G345090|TK1151|PROTEIN

MVTEKRQPLQSSTTDNIPPATKPAATKAGRTIEETYQKKTQLEHILLRPDTYIGSIEKHEQTLWVWEEEKMVKRCISYVPGLYKIFDEILVNAADNKQRDPKMDCVKVTIDPDQNLITVYNNGDGIPVEVHQEEGVYVPEMIFGHLLTSSNYDDSIKKTTGGRNGYGAKLANIFSTEFTIETADGKRNRRYKQVFSNNMGKKSEPAITKCKSGENWTMVSFKPDLSKFGMECLEPDVVALMKKRVVDLAGCLGKTVKVEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G345090`
TK1151 ID	TkA08G345090
OH-1004 ID	LXL04_034048
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.053 / OH-1004 83.223 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G345090

Location Chr08:88466894-88472945 (+)

Description Similar to TOP2: DNA topoisomerase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23890`	Control of topological states of DNA by transient breakage and subsequent rejoining of DNA strands.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034048 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0000819 sister chromatid segregation Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007076 mitotic chromosome condensation Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0030261 chromosome condensation Biological Process

GO:0040016 embryonic cleavage Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045870 positive regulation of single stranded viral RNA replication via double stranded DNA intermediate Biological Process

KEGG gene cross-reference

ath:AT3G23890

cge:100689304

mmu:21973

spo:2540541

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.486

Rank 1 · TkA08G345090 · TK1151

Cytoplasm0.454

Rank 2 · TkA08G345090 · TK1151

Mitochondrion0.057

Rank 3 · TkA08G345090 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA08G345090 · TK1151

Cell membrane0.040

Rank 5 · TkA08G345090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518HATPase_c81-177 aa

PF00204DNA_gyraseB270-422 aa

PF08722Tn7_TnsA-like_N371-449 aa

PF01751Toprim451-550 aa

PF16898TOPRIM_C566-694 aa

PF01751Toprim631-650 aa

PF00521DNA_topoisoIV697-1165 aa

PF02518HATPase_c948-976 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G345090	`PF02518`	HATPase_c	81	177	5.6e-10	40.4
TkA08G345090	`PF00204`	DNA_gyraseB	270	422	4.6e-25	88.8
TkA08G345090	`PF08722`	Tn7_TnsA-like_N	371	449	0.015	16.6
TkA08G345090	`PF01751`	Toprim	451	550	2.6e-08	34.6
TkA08G345090	`PF16898`	TOPRIM_C	566	694	6.7e-49	166.0
TkA08G345090	`PF01751`	Toprim	631	650	2.6e-08	34.6
TkA08G345090	`PF00521`	DNA_topoisoIV	697	1165	3.4e-119	399.3
TkA08G345090	`PF02518`	HATPase_c	948	976	5.6e-10	40.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P30182`	Arabidopsis thaliana	sp\|P30182\|TOP2_ARATH DNA topoisomerase 2	64.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card