TkA08G342790 | RubberDandelionOmics

Gene overview

TkA08G342790

Reference: TK1151 Chr: Chr08 Coordinates: 87870268-87874766 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA08G342790|TK1151|cDNA

ATGACTTTAAAGAGAAATTGGCAGCCTATTATCGACAAGGTGCAAGCGAAACTTTCGGGATGGAAAGCTAAAACTCTTTCCTTTGGAGGCAGGTTAACCTTGGTGAAATCCGTTTTGGGTAGTCTGCCCATCTTCTATTTCTCGCTGTTCAAAGCTCCCGTCTCGGTTATCCAACTGCTAGAGAAATTGCGTAGGCGATTTCTATGGGGCGGTTGTGAAGATAAAAACAAGATAAATTGGGTTGCTTGGCAAACAGTTCT...

CDS

Download CDS FASTA

1122 bp · TkA08G342790|TK1151|CDS

ATGACTTTAAAGAGAAATTGGCAGCCTATTATCGACAAGGTGCAAGCGAAACTTTCGGGATGGAAAGCTAAAACTCTTTCCTTTGGAGGCAGGTTAACCTTGGTGAAATCCGTTTTGGGTAGTCTGCCCATCTTCTATTTCTCGCTGTTCAAAGCTCCCGTCTCGGTTATCCAACTGCTAGAGAAATTGCGTAGGCGATTTCTATGGGGCGGTTGTGAAGATAAAAACAAGATAAATTGGGTTGCTTGGCAAACAGTTCT...

Protein

Download Protein FASTA

373 aa · TkA08G342790|TK1151|PROTEIN

MTLKRNWQPIIDKVQAKLSGWKAKTLSFGGRLTLVKSVLGSLPIFYFSLFKAPVSVIQLLEKLRRRFLWGGCEDKNKINWVAWQTVLGPKDKGIWFNIVKIVPVLLEIGIQISDIFEVQVHSVSNTLLWLDGWDVNGTLTSRFPLLFELERRKACFISERVTSDGIIWAWKKIPKRPTEADELSNLNNLADVRTLIDSKVTSSVENPAVWNNLVPIKVFTFVWRACLDRVPSAVALSRRGISVLSLSCHLCDEHLDATDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G342790`
TK1151 ID	TkA08G342790
OH-1004 ID	LXL04_014455
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.100
Protein coverage (%)	TK1151 100.000 / OH-1004 22.582 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G342790

Location Chr08:87870268-87874766 (-)

Description Similar to Os01g0810000: Probable U3 small nucleolar RNA-associated protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65750`	Putative ribonuclease H protein At1g65750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014455 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006364 rRNA processing Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0032040 small-subunit processome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT3G60360

dosa:Os01g0810000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.578

Rank 1 · TkA08G342790 · TK1151

Nucleus0.282

Rank 2 · TkA08G342790 · TK1151

Cell membrane0.160

Rank 3 · TkA08G342790 · TK1151

Golgi apparatus0.050

Rank 4 · TkA08G342790 · TK1151

Lysosome / Vacuole0.046

Rank 5 · TkA08G342790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT205-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G342790	`PF13966`	zf-RVT	205	270	1.4e-13	52.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C2F6`	Arabidopsis thaliana	sp\|P0C2F6\|RNHX1_ARATH Putative ribonuclease H protein At1g65750	45.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card