TkA08G342480 | RubberDandelionOmics

Gene overview

TkA08G342480

Reference: TK1151 Chr: Chr08 Coordinates: 87800310-87801541 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1024 bp · TkA08G342480|TK1151|cDNA

GTTTAGTTAGTGCATTCCTTTGGCTTTATTGTTTAGTTCTTTTGTACGGTTTTTTCTGTTGTTGTTTTGGTTGCTTTTGGTTGCTTTGGACTCTTTGTTGTGTTAGCTTCCTGCTAACTAGTGTGGTTTTATTTTATAATATTTGTTTGTTGCCGATCAAAAAAAAAAAGTGTGACAAAAATAACATCTTCTAGATATTTAAAACAATAATTTATGCCATGAAAAGTGGTTTTATATGAGAGCTACATCCATGATCCATA...

CDS

Download CDS FASTA

480 bp · TkA08G342480|TK1151|CDS

ATGAAGGATGAGCAAGCGACGTACATCAGGATGAAAATCATGTCGTACTTGGCTTACGATAGAGTTAGAATGGATTTGATTAAAGATGGTGAAAAGAAAGGGCTAATTTCTAAGACATGGGAACGATGCAAATCATTTCGTGGTGTTGAAGCTCATAGCTCATCTAAGATCAAACGACCTTTTATCAAGAAAAGCAAATCATGGTCTCCAAAAGATGCAAATACAATAGCTTATATTGCTCCAAAAGGTTGTTTGTCAGT...

Protein

Download Protein FASTA

159 aa · TkA08G342480|TK1151|PROTEIN

MKDEQATYIRMKIMSYLAYDRVRMDLIKDGEKKGLISKTWERCKSFRGVEAHSSSKIKRPFIKKSKSWSPKDANTIAYIAPKGCLSVYVGPQRQRFVIKTECANHPLFKAFLEEAECEYGYKNEGPLELPCEVNDFVKFMVEMNDDSEISGAKGCIFHH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G342480`
TK1151 ID	TkA08G342480
OH-1004 ID	LXL04_009344
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	41.900
Protein coverage (%)	TK1151 77.358 / OH-1004 72.024 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G342480`
Location	Chr08:87800310-87801541 (+)
Description	Similar to SAUR32: Auxin-responsive protein SAUR32
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009344` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009639 response to red or far red light Biological Process GO:0009641 shade avoidance Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0010202 response to low fluence red light stimulus Biological Process GO:0051510 regulation of unidimensional cell growth Biological Process GO:0060560 developmental growth involved in morphogenesis Biological Process GO:1900140 regulation of seedling development Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G56150 ath:AT1G79130 ath:AT2G18010 ath:AT2G46690 ath:AT3G12830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · TkA08G342480 · TK1151

Nucleus0.347

Rank 2 · TkA08G342480 · TK1151

Cell membrane0.276

Rank 3 · TkA08G342480 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA08G342480 · TK1151

Plastid0.059

Rank 5 · TkA08G342480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27046FAM200-GTF2IRD2-like32-47 aa

PF02519Auxin_inducible58-141 aa

PF27046FAM200-GTF2IRD2-like97-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G342480	`PF27046`	FAM200-GTF2IRD2-like	32	47	0.081	13.5
TkA08G342480	`PF02519`	Auxin_inducible	58	141	5.1e-20	72.2
TkA08G342480	`PF27046`	FAM200-GTF2IRD2-like	97	120	0.081	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card