TkA08G341560 | RubberDandelionOmics

Gene overview

TkA08G341560

Reference: TK1151 Chr: Chr08 Coordinates: 87582092-87584891 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

768 bp · TkA08G341560|TK1151|CDS

ATGTTGAGGATTATAAAACAAAAAGTCGGTGCGAGAGGCTTCTCGGCTCCGGTATTTGGGGATTACATGCAGCGATTAATCCCTGTAGCATCATCCATGAAACATTTCTCATCTACAACCAAAAATATGACAGTAAGAGATGCTCTGAACTCTGCTCTCGATGAGGAAATGGCAGCTGATTCCAACGTCTTTATCATGGGTGAAGAAGTCGGAGAATACCAGGGTGCATACAAGATCACAAAAGGATTGCTAGACAAGTA...

Protein

Download Protein FASTA

255 aa · TkA08G341560|TK1151|PROTEIN

MLRIIKQKVGARGFSAPVFGDYMQRLIPVASSMKHFSSTTKNMTVRDALNSALDEEMAADSNVFIMGEEVGEYQGAYKITKGLLDKYGPDRVVDTPITEAGFTGIGVGAAYHGLKPVIEFMTFNFSMQAIDHIINSAAKSNYMSAGQINVPIVFRGPNGAAAGVGAQHSQCFGAWFGAIPGLKVLVPYSSEDARGLLKAAIRDPDPVVFLENEILYGESFPVSPEVLDPNFCLPIGKARLKEKGKMLQSQLTPRW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G341560`
TK1151 ID	TkA08G341560
OH-1004 ID	LXL04_025727
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.400
Protein coverage (%)	TK1151 90.980 / OH-1004 52.515 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G341560

Location Chr08:87582092-87584891 (-)

Description Similar to Os08g0536000: Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50850`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0536000`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release
`Os09g0509200`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009536 plastid Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G50850

dme:Dmel_CG11876

dosa:Os08g0536000

dosa:Os09g0509200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.943

Rank 1 · TkA08G341560 · TK1151

Cytoplasm0.039

Rank 2 · TkA08G341560 · TK1151

Nucleus0.028

Rank 3 · TkA08G341560 · TK1151

Plastid0.024

Rank 4 · TkA08G341560 · TK1151

Cell membrane0.016

Rank 5 · TkA08G341560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02779Transket_pyr42-216 aa

PF01546Peptidase_M2063-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G341560	`PF02779`	Transket_pyr	42	216	1.9e-44	152.1
TkA08G341560	`PF01546`	Peptidase_M20	63	147	0.24	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38799`	Arabidopsis thaliana	sp\|Q38799\|ODPB1_ARATH Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial	81.800%	Swiss-Prot	High
`Q6Z1G7`	Oryza sativa subsp. japonica	sp\|Q6Z1G7\|ODPB1_ORYSJ Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial	76.500%	Swiss-Prot	High
`Q0J0H4`	Oryza sativa subsp. japonica	sp\|Q0J0H4\|ODPB2_ORYSJ Pyruvate dehydrogenase E1 component subunit beta-2, mitochondrial	73.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card