TkA08G341400 | RubberDandelionOmics

Gene overview

TkA08G341400

Reference: TK1151 Chr: Chr08 Coordinates: 87524767-87530507 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4987 bp · TkA08G341400|TK1151|cDNA

CCCACCCCCGCTTTTCTTTTCCTATTTATTTTTCTTCTTCGCCTCCCTCGTTACTCTCTGCTCATCTGTTTTCTCGATTCACACTTTCCCCTGCCCGTCGTTTGATCTTGATTTTGATTTAACGCATCAAATCAACGTTTGATTTTCGCATTTAAATCTCGGATTTTGGTATATAATTTCAAAATCGCAACGCATTTAGGGCTAGAAATAATTGCAAACCCTAGCCCGCAAGTTTGTCACGTTTTTCCCTTTTCTTTCGT...

CDS

Download CDS FASTA

699 bp · TkA08G341400|TK1151|CDS

ATGGGGAAAGATTTATTGGTATCTGTAGGTGTGGATGTAGAGGAGGGTGAAATTTCGGATTCGACGTCTATTGAAGAGATCAGTGCGGAGGATTTTGGTGTTAAGTCGCCGCCGATTGGGACAGAGATTGCTGCTTCTAAGAATGCAGTCGATGATGATTCCAAGCAACAACAGCAGCAGCATCAGCAAGTTTGGACGATGCAGGATCTGTTAAAGTATCAGAATAAGTATCATAGGAATTACGCACCTGGCTTGTATAA...

Protein

Download Protein FASTA

232 aa · TkA08G341400|TK1151|PROTEIN

MGKDLLVSVGVDVEEGEISDSTSIEEISAEDFGVKSPPIGTEIAASKNAVDDDSKQQQQQHQQVWTMQDLLKYQNKYHRNYAPGLYNFAWAQAVQNKPLDDYLTTMNTSTPTDNNLKQALLNDDNNNIEVKKEVTVNNDKDVVDISDDGESEKEEGELEEGEIDLDMEVVNAGKQGGVEDNVEKWINIIRIGLESITINDAKKSFTGVCSRLEDFLDSFSKLFSRKIHIQQR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G341400`
TK1151 ID	TkA08G341400
OH-1004 ID	LXL04_025720
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 97.414 / OH-1004 20.452 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G341400`
Location	Chr08:87524767-87530507 (-)
Description	Similar to CPL3: RNA polymerase II C-terminal domain phosphatase-like 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025720` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:1900369 negative regulation of post-transcriptional gene silencing by regulatory ncRNA Biological Process GO:1902074 response to salt Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process
KEGG gene cross-reference	ath:AT2G33540 ath:AT3G19595 ath:AT3G19600 ath:AT5G58003 cel:CELE_F36F2.6 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · TkA08G341400 · TK1151

Cytoplasm0.204

Rank 2 · TkA08G341400 · TK1151

Mitochondrion0.029

Rank 3 · TkA08G341400 · TK1151

Cell membrane0.021

Rank 4 · TkA08G341400 · TK1151

Golgi apparatus0.010

Rank 5 · TkA08G341400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25505ARM_CPL356-73 aa

PF26875Phage_T4_Y06R60-96 aa

PF25505ARM_CPL3186-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G341400	`PF25505`	ARM_CPL3	56	73	5e-10	40.0
TkA08G341400	`PF26875`	Phage_T4_Y06R	60	96	0.11	13.5
TkA08G341400	`PF25505`	ARM_CPL3	186	226	5e-10	40.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card