TkA08G341370 | RubberDandelionOmics

Gene overview

TkA08G341370

Reference: TK1151 Chr: Chr08 Coordinates: 87514772-87517475 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1151 bp · TkA08G341370|TK1151|cDNA

ATAAGCACCTCTTTATTCTAGTAAATCGAAGAATATCTATCTCATATGATTTTGATGCATCTATCGTCTCCTATACTATCCTCCACTCCACCTACTATATACAAGCATATCCAGATAGTCAAACTTTGAACAACTTTTTTTCGCTACAGAATAATCATTTATTCACAGTGGATCATCGAAGAAGACATGGATAGTATACATGAGAAGTTCCATGTGGGAGCAAACGCAGATCGTAGGAGCAAATCATGTCGCCGATGATG...

CDS

Download CDS FASTA

729 bp · TkA08G341370|TK1151|CDS

ATGAGAAGTTCCATGTGGGAGCAAACGCAGATCGTAGGAGCAAATCATGTCGCCGATGATGTTTACGGCGGTTTCATGATCCCTAACTACCCAACTCCACCTCCTCCCTCAATGATAGTAACACCTCAACTACAAAATCAACAACCTATTCAACAAGAAGTGAAAAGGCATTATAGAGGAGTAAGGCAAAGGCCATGGGGAAAATGGGCAGCTGAAATACGAGACCCCAATAAAGGCGCACGTGTTTGGTTAGGCACTTT...

Protein

Download Protein FASTA

242 aa · TkA08G341370|TK1151|PROTEIN

MRSSMWEQTQIVGANHVADDVYGGFMIPNYPTPPPPSMIVTPQLQNQQPIQQEVKRHYRGVRQRPWGKWAAEIRDPNKGARVWLGTFETAEGAALAYDQAALKFKGSKAKLNFPERFQGSSELRFISTTAQPPPPAISPPSQPHPLNHTIATSYPDFLQYAQLLSSNDAQMPSYFTSTLYHHNINATQPYSSNQSSPSSSASMVGSSTISYQQPNYGDNSRFSSDSGMDPWTGGFDHGNRNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G341370`
TK1151 ID	TkA08G341370
OH-1004 ID	LXL04_025719
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 99.174 / OH-1004 85.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G341370

Location Chr08:87514772-87517475 (-)

Description Similar to ERF113: Ethylene-responsive transcription factor ERF113

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13330`	Transcriptional activator involved in the regulation of plant development and tolerance to abiotic stresses.	Functional characterization of four APETALA2-family genes (RAP2.6, RAP2.6L, DREB19 and DREB26) in Arabidopsis.2011 · DOI: 10.1007/s11103-010-9711-7 RAP2.6L overexpression delays waterlogging induced premature senescence by increasing stomatal closure more than antioxidant enzyme activity.2012 · DOI: 10.1007/s11103-012-9936-8
`At5g61890`	Transcriptional regulator of cell proliferation and axillary bud outgrowth.	EBE, an AP2/ERF transcription factor highly expressed in proliferating cells, affects shoot architecture in Arabidopsis.2013 · DOI: 10.1104/pp.113.214049
`At5g07310`	Acts as a transcriptional activator of the phytosulfokine PSK5 peptide hormone.	No verified direct reference in this release
`At2g33710`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g50080`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025719 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G33710

ath:AT2G47520

ath:AT5G07310

ath:AT5G13330

ath:AT5G61890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA08G341370 · TK1151

Cytoplasm0.086

Rank 2 · TkA08G341370 · TK1151

Endoplasmic reticulum0.029

Rank 3 · TkA08G341370 · TK1151

Cell membrane0.028

Rank 4 · TkA08G341370 · TK1151

Plastid0.018

Rank 5 · TkA08G341370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP257-106 aa

PF30938ATR7100-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G341370	`PF00847`	AP2	57	106	1.2e-15	58.3
TkA08G341370	`PF30938`	ATR7	100	211	1.4	9.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYU3`	Arabidopsis thaliana	sp\|Q9LYU3\|EF113_ARATH Ethylene-responsive transcription factor ERF113	54.200%	Swiss-Prot	Medium
`Q9FH54`	Arabidopsis thaliana	sp\|Q9FH54\|EF114_ARATH Ethylene-responsive transcription factor ERF114	55.600%	Swiss-Prot	Medium
`Q9LY29`	Arabidopsis thaliana	sp\|Q9LY29\|EF115_ARATH Ethylene-responsive transcription factor ERF115	58.200%	Swiss-Prot	Medium
`P93007`	Arabidopsis thaliana	sp\|P93007\|EF112_ARATH Ethylene-responsive transcription factor ERF112	64.800%	Swiss-Prot	Low
`Q70II3`	Arabidopsis thaliana	sp\|Q70II3\|EF110_ARATH Ethylene-responsive transcription factor ERF110	53.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card