RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G329370
Reference: TK1151 Chr: Chr08 Coordinates: 84783806-84785578 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

444 bp · TkA08G329370|TK1151|cDNA

ATGGGTATAACCTTGATGGGTGCCGAATCCATCAAACAAAAAGTCCTATTTGCACTTCATGATTCAAAAACAATGGTAGTAGTGGTAAACAGGGTCGATCCTCAGGGACTCGACACCCCATTCACGCCATTATGGAGACAAGATCAAGCCATTTACGCCCCTAGCTCCTTGGAGGGTTCCATTCACGACTCCAGCTCCCAAAATGGACATGTTCACGCCTCCAAGAGGCTGTTCACGCCTCCTACCTTTTTGGGATACCC...

CDS

Download CDS FASTA

444 bp · TkA08G329370|TK1151|CDS

ATGGGTATAACCTTGATGGGTGCCGAATCCATCAAACAAAAAGTCCTATTTGCACTTCATGATTCAAAAACAATGGTAGTAGTGGTAAACAGGGTCGATCCTCAGGGACTCGACACCCCATTCACGCCATTATGGAGACAAGATCAAGCCATTTACGCCCCTAGCTCCTTGGAGGGTTCCATTCACGACTCCAGCTCCCAAAATGGACATGTTCACGCCTCCAAGAGGCTGTTCACGCCTCCTACCTTTTTGGGATACCC...

Protein

Download Protein FASTA

147 aa · TkA08G329370|TK1151|PROTEIN

MGITLMGAESIKQKVLFALHDSKTMVVVVNRVDPQGLDTPFTPLWRQDQAIYAPSSLEGSIHDSSSQNGHVHASKRLFTPPTFLGYPFMPPSSKKGSNHAPLKAIHASKRLFTPPAFRVKPMTPQAPRRELFTPPMGCSRPWCLLGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G329370
TK1151 IDTkA08G329370
OH-1004 IDLXL04_037350
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)79.600
Protein coverage (%)TK1151 73.469 / OH-1004 24.368
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G329370
LocationChr08:84783806-84785578 (+)
DescriptionSimilar to URT1: UTP:RNA uridylyltransferase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037350 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening Biological Process
GO:0006397 mRNA processing Biological Process
GO:0010468 regulation of gene expression Biological Process
GO:0010586 miRNA metabolic process Biological Process
GO:0010587 miRNA catabolic process Biological Process
GO:0010605 negative regulation of macromolecule metabolic process Biological Process
GO:0019827 stem cell population maintenance Biological Process
GO:0031054 pre-miRNA processing Biological Process
GO:0031123 RNA 3'-end processing Biological Process
GO:0141008 transposable element silencing by mRNA destabilization Biological Process
GO:1900369 negative regulation of post-transcriptional gene silencing by regulatory ncRNA Biological Process
GO:1990074 polyuridylation-dependent mRNA catabolic process Biological Process
KEGG gene cross-reference
ath:AT2G45620
hsa:23318
hsa:79670
mmu:214290
spo:2539762
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.470
Rank 1 · TkA08G329370 · TK1151
Nucleus0.351
Rank 2 · TkA08G329370 · TK1151
Mitochondrion0.130
Rank 3 · TkA08G329370 · TK1151
Cell membrane0.099
Rank 4 · TkA08G329370 · TK1151
Extracellular0.089
Rank 5 · TkA08G329370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser