TkA08G315580 | RubberDandelionOmics

Gene overview

TkA08G315580

Reference: TK1151 Chr: Chr08 Coordinates: 81554066-81554564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · TkA08G315580|TK1151|cDNA

TCTGTCGATTCAACAATGTTTCTGTTTGATTGGTTCTATGGCATCCTGGCCTCCCTCGGTTTATGGCAGAAAGAAGCCAAGATCTTGTTCCTTGGCCTCGATAATGCTGGTAAAACTACCTTGCTTCACATGCTTAAAGACGAGAGATTAGTTCAACATCAACCGACGCAACATCCGACCTCCGAAGAATTGAGTATTGGGAAAATCAAGTTCAAAGCCTTCGATTTGGGAGGTCATCAGATTGCTCGTAGAGTCTGGAA...

CDS

Download CDS FASTA

363 bp · TkA08G315580|TK1151|CDS

ATGTTTCTGTTTGATTGGTTCTATGGCATCCTGGCCTCCCTCGGTTTATGGCAGAAAGAAGCCAAGATCTTGTTCCTTGGCCTCGATAATGCTGGTAAAACTACCTTGCTTCACATGCTTAAAGACGAGAGATTAGTTCAACATCAACCGACGCAACATCCGACCTCCGAAGAATTGAGTATTGGGAAAATCAAGTTCAAAGCCTTCGATTTGGGAGGTCATCAGATTGCTCGTAGAGTCTGGAAGGATTGTTACGCCAA...

Protein

Download Protein FASTA

120 aa · TkA08G315580|TK1151|PROTEIN

MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDCYAKVCDFCIWFLSKYDIFKIIRFVFHCHLFPNLQHI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G315580`
TK1151 ID	TkA08G315580
OH-1004 ID	LXL04_033841
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G315580

Location Chr08:81554066-81554564 (+)

Description Similar to SAR1B: GTP-binding protein SAR1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56330`	Small GTPase that cycles between an active GTP-bound and an inactive GDP-bound state and mainly functions in vesicle-mediated endoplasmic reticulum (ER) to Golgi transport.	No verified direct reference in this release
`At4g02080`	Small GTPase that cycles between an active GTP-bound and an inactive GDP-bound state and mainly functions in vesicle-mediated endoplasmic reticulum (ER) to Golgi transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033841 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003400 regulation of COPII vesicle coating Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009555 pollen development Biological Process

GO:0016050 vesicle organization Biological Process

GO:0061024 membrane organization Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

KEGG gene cross-reference

ath:AT1G56330

ath:AT4G02080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.459

Rank 1 · TkA08G315580 · TK1151

Golgi apparatus0.306

Rank 2 · TkA08G315580 · TK1151

Cytoplasm0.224

Rank 3 · TkA08G315580 · TK1151

Nucleus0.130

Rank 4 · TkA08G315580 · TK1151

Cell membrane0.100

Rank 5 · TkA08G315580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf8-97 aa

PF00503G-alpha19-41 aa

PF09439SRPRB19-78 aa

PF10662PduV-EutP21-52 aa

PF01926MMR_HSR122-75 aa

PF08477Roc22-96 aa

PF00503G-alpha48-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G315580	`PF00025`	Arf	8	97	7.8e-31	107.6
TkA08G315580	`PF00503`	G-alpha	19	41	6.5e-07	29.5
TkA08G315580	`PF09439`	SRPRB	19	78	0.00034	20.7
TkA08G315580	`PF10662`	PduV-EutP	21	52	0.013	16.0
TkA08G315580	`PF01926`	MMR_HSR1	22	75	0.00011	23.1
TkA08G315580	`PF08477`	Roc	22	96	0.0003	21.7
TkA08G315580	`PF00503`	G-alpha	48	97	6.5e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q01474`	Arabidopsis thaliana	sp\|Q01474\|SAR1B_ARATH Small COPII coat GTPase SAR1B	90.000%	Swiss-Prot	High
`O04834`	Arabidopsis thaliana	sp\|O04834\|SAR1A_ARATH Small COPII coat GTPase SAR1A	87.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card