TkA08G312800 | RubberDandelionOmics

Gene overview

TkA08G312800

Reference: TK1151 Chr: Chr08 Coordinates: 80858078-80859729 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

694 bp · TkA08G312800|TK1151|cDNA

GTGGGTGCTTTTGTATAATTTACTCTTATCATAATGGAGTCCGATGTAAACATAATTGCTCACCATGTTCTTTTGTTTGTGTATATGTTATGTTGAGAGATATGTGTTGCTGTGTGTATTTTGCACTCGTTGTGTTTAAGTCATCTTTCTTTGGCACCATTAAAGTTTGGGTCCTTCAACCCGCATGATGGAACAATATGAATGAGCACGATTTGAATAACTTAATCCCTATCTTTTTGCAGTTGCAGATGTTGCATACA...

CDS

Download CDS FASTA

303 bp · TkA08G312800|TK1151|CDS

ATGAAACCAAGGATTTTTGGGAGCAAATTAAAACACCTGGCACACGTCCCCCATCTTTTGACCGAAGGAGATGGTACAAAAAGTGCCACCATAATTGGTAATGTTTATATTCACCCCTCAGCTAAAGTTCATCCCACTGCAAAGATTGGTCCAAACGTTTCCATATCTGTCGATGCAGATATTGGAGCCGGTGTACGGTTAATCAACTTTATTATTCTTGATGATGTTAAAATCAATTATCGGGCGGTGGTCATGAGTAA...

Protein

Download Protein FASTA

100 aa · TkA08G312800|TK1151|PROTEIN

MKPRIFGSKLKHLAHVPHLLTEGDGTKSATIIGNVYIHPSAKVHPTAKIGPNVSISVDADIGAGVRLINFIILDDVKINYRAVVMSKIMWFYEENMGVDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G312800`
TK1151 ID	TkA08G312800
OH-1004 ID	LXL04_033892
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 90.000 / OH-1004 91.837 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G312800`
Location	Chr08:80858078-80859729 (-)
Description	Similar to gmppaa: Mannose-1-phosphate guanyltransferase alpha-A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033892` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009100 glycoprotein metabolic process Biological Process GO:0009101 glycoprotein biosynthetic process Biological Process GO:0009298 GDP-mannose biosynthetic process Biological Process GO:0019673 GDP-mannose metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0120508 GDP-mannose pyrophosphorylase complex Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function GO:0005525 GTP binding Molecular Function GO:0016740 transferase activity Molecular Function GO:0016779 nucleotidyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:29926 mmu:69080 panu:100137607 rno:501167 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.420

Rank 1 · TkA08G312800 · TK1151

Nucleus0.269

Rank 2 · TkA08G312800 · TK1151

Extracellular0.107

Rank 3 · TkA08G312800 · TK1151

Mitochondrion0.091

Rank 4 · TkA08G312800 · TK1151

Plastid0.087

Rank 5 · TkA08G312800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00132Hexapep30-55 aa

PF25087GMPPB_C31-88 aa

PF25084LbH_EIF2B33-89 aa

PF00132Hexapep60-67 aa

PF00132Hexapep72-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G312800	`PF00132`	Hexapep	30	55	2.9e-05	24.3
TkA08G312800	`PF25087`	GMPPB_C	31	88	2.2e-16	60.3
TkA08G312800	`PF25084`	LbH_EIF2B	33	89	0.00071	20.3
TkA08G312800	`PF00132`	Hexapep	60	67	2.9e-05	24.3
TkA08G312800	`PF00132`	Hexapep	72	86	2.9e-05	24.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card