TkA08G306760 | RubberDandelionOmics

Gene overview

TkA08G306760

Reference: TK1151 Chr: Chr08 Coordinates: 79366880-79367959 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA08G306760|TK1151|cDNA

ATGATGCACCCAATTGACACTGTGAAAACTCGAATCCAAAGTCAAGCCATCTTGACTCAATCCCAGAAACAAAAGAGTATATTACAGATGGTGAAAGCTGTCTGGGGTGCTGATGGCTTAAGAGGGTTTTACAGAGGTGTTGCACCTGGAGTAACTGGATCACTTGTAACTGGTGCAACATATTTTGGTGTAATAGAATCAACAAAAAAATGGATGGAAGAAACTCACCCAAATCTTGGAGGTCACTGGGCCCACTTCAT...

CDS

Download CDS FASTA

588 bp · TkA08G306760|TK1151|CDS

ATGATGCACCCAATTGACACTGTGAAAACTCGAATCCAAAGTCAAGCCATCTTGACTCAATCCCAGAAACAAAAGAGTATATTACAGATGGTGAAAGCTGTCTGGGGTGCTGATGGCTTAAGAGGGTTTTACAGAGGTGTTGCACCTGGAGTAACTGGATCACTTGTAACTGGTGCAACATATTTTGGTGTAATAGAATCAACAAAAAAATGGATGGAAGAAACTCACCCAAATCTTGGAGGTCACTGGGCCCACTTCAT...

Protein

Download Protein FASTA

195 aa · TkA08G306760|TK1151|PROTEIN

MMHPIDTVKTRIQSQAILTQSQKQKSILQMVKAVWGADGLRGFYRGVAPGVTGSLVTGATYFGVIESTKKWMEETHPNLGGHWAHFIAGALGDTLGSFIYVPCEVIKQRMQVQGTRKYWTSVVMKDAALDSTMYAYYSGMFQAGCSIWKDQGPKGLYAGYWSTLVRDVPFAGLMVTCYEALNHGGYYYMFFLRIY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G306760`
TK1151 ID	TkA08G306760
OH-1004 ID	LXL04_031464
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 94.359 / OH-1004 54.354 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G306760

Location Chr08:79366880-79367959 (+)

Description Similar to SAMC1: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39460`	Transporter involved in exchange reactions through membranes.	Molecular identification of an Arabidopsis S-adenosylmethionine transporter. Analysis of organ distribution, bacterial expression, reconstitution into liposomes, and functional characterization.2006 · DOI: 10.1104/pp.106.086975 Arabidopsis SAMT1 defines a plastid transporter regulating plastid biogenesis and plant development.2006 · DOI: 10.1105/tpc.105.040741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031464 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0015693 magnesium ion transport Biological Process

GO:0015805 S-adenosyl-L-methionine transport Biological Process

GO:0048250 iron import into the mitochondrion Biological Process

GO:1990616 magnesium ion export from mitochondrion Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

KEGG gene cross-reference

ath:AT1G34065

ath:AT4G39460

ddi:DDB_G0269394

ddi:DDB_G0269470

sce:YMR166C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.915

Rank 1 · TkA08G306760 · TK1151

Cytoplasm0.037

Rank 2 · TkA08G306760 · TK1151

Nucleus0.024

Rank 3 · TkA08G306760 · TK1151

Plastid0.019

Rank 4 · TkA08G306760 · TK1151

Cell membrane0.018

Rank 5 · TkA08G306760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr2-74 aa

PF00153Mito_carr83-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G306760	`PF00153`	Mito_carr	2	74	1.1e-36	125.1
TkA08G306760	`PF00153`	Mito_carr	83	182	1.1e-36	125.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AG6`	Arabidopsis thaliana	sp\|Q94AG6\|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial	35.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card