TkA08G304570 | RubberDandelionOmics

Gene overview

TkA08G304570

Reference: TK1151 Chr: Chr08 Coordinates: 78900105-78900682 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA08G304570|TK1151|cDNA

ATGTCCTGTAACAATGCAGTGAAGGAGGATAAAAACGGTAGAGTTGTTCCAGAGCATGATAGAGAGATATTGGTAGCACACATGGATTTTGCTAAAAAGGCAGAAATTTATGGTAATAATATGTTTCCACATGACACCGAAAGTTCAAATCACGTGCTACTAAATTATCCAAAGGAGAACACAAAAATCGGATTAGTTCGATGCCCAAGCTGCCTGAAAGTTCTGTTGGAGCCGCCAGATGTTCCAGTCTACGGATGTGG...

CDS

Download CDS FASTA

360 bp · TkA08G304570|TK1151|CDS

ATGTCCTGTAACAATGCAGTGAAGGAGGATAAAAACGGTAGAGTTGTTCCAGAGCATGATAGAGAGATATTGGTAGCACACATGGATTTTGCTAAAAAGGCAGAAATTTATGGTAATAATATGTTTCCACATGACACCGAAAGTTCAAATCACGTGCTACTAAATTATCCAAAGGAGAACACAAAAATCGGATTAGTTCGATGCCCAAGCTGCCTGAAAGTTCTGTTGGAGCCGCCAGATGTTCCAGTCTACGGATGTGG...

Protein

Download Protein FASTA

119 aa · TkA08G304570|TK1151|PROTEIN

MSCNNAVKEDKNGRVVPEHDREILVAHMDFAKKAEIYGNNMFPHDTESSNHVLLNYPKENTKIGLVRCPSCLKVLLEPPDVPVYGCGGCNAILIVKKQKDATADIEVNAGNFSCFKKFI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G304570`
TK1151 ID	TkA08G304570
OH-1004 ID	LXL04_033724
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 31.933 / OH-1004 11.950 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G304570`
Location	Chr08:78900105-78900682 (-)
Description	Similar to HERK1: Receptor-like protein kinase HERK 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033724` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009741 response to brassinosteroid Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0010038 response to metal ion Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010483 pollen tube reception Biological Process GO:0005576 extracellular region Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009536 plastid Cellular Component GO:0043680 filiform apparatus Cellular Component GO:0099503 secretory vesicle Cellular Component
KEGG gene cross-reference	ath:AT2G39360 ath:AT3G46290 ath:AT5G38990 ath:AT5G39000 ath:AT5G59700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.433

Rank 1 · TkA08G304570 · TK1151

Cytoplasm0.381

Rank 2 · TkA08G304570 · TK1151

Cell membrane0.140

Rank 3 · TkA08G304570 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA08G304570 · TK1151

Mitochondrion0.080

Rank 5 · TkA08G304570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24292DUF747950-77 aa

PF06943zf-LSD151-57 aa

PF23548Zn_ribbon_FGT1_253-71 aa

PF22910EDR4-like_1st62-93 aa

PF30462DUF861762-115 aa

PF06943zf-LSD166-71 aa

PF24292DUF747981-96 aa

PF23548Zn_ribbon_FGT1_286-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G304570	`PF24292`	DUF7479	50	77	0.0032	18.3
TkA08G304570	`PF06943`	zf-LSD1	51	57	0.85	10.3
TkA08G304570	`PF23548`	Zn_ribbon_FGT1_2	53	71	0.83	10.0
TkA08G304570	`PF22910`	EDR4-like_1st	62	93	2.4e-14	53.3
TkA08G304570	`PF30462`	DUF8617	62	115	0.11	13.6
TkA08G304570	`PF06943`	zf-LSD1	66	71	0.85	10.3
TkA08G304570	`PF24292`	DUF7479	81	96	0.0032	18.3
TkA08G304570	`PF23548`	Zn_ribbon_FGT1_2	86	93	0.83	10.0
TkA08G304570	`PF06943`	zf-LSD1	86	94	0.85	10.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card