TkA08G302010 | RubberDandelionOmics

Gene overview

TkA08G302010

Reference: TK1151 Chr: Chr08 Coordinates: 78214638-78215261 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA08G302010|TK1151|cDNA

ATGGCTGTTGAAGCTTTGATCGGAGCTGGGGTAGGGGACGCCGTTTCTAAGTTATCAGATGCCATCATACACGTACTAAAAACAACTTGGCAGTTTAGATCCAAACTCACTCAAATACAAGAAACCATAACGAGCAACAAACTGATCTTCGATGAAATCGAGAAACTAATTGAAGAATTGGATCGACCGAAAGAGGAAAAGGAGAAGTTCGCCGCTCAGATGAAAGGCGCGGAAGCTCTCGTTCTCAAATGCGAGCAAAT...

CDS

Download CDS FASTA

624 bp · TkA08G302010|TK1151|CDS

ATGGCTGTTGAAGCTTTGATCGGAGCTGGGGTAGGGGACGCCGTTTCTAAGTTATCAGATGCCATCATACACGTACTAAAAACAACTTGGCAGTTTAGATCCAAACTCACTCAAATACAAGAAACCATAACGAGCAACAAACTGATCTTCGATGAAATCGAGAAACTAATTGAAGAATTGGATCGACCGAAAGAGGAAAAGGAGAAGTTCGCCGCTCAGATGAAAGGCGCGGAAGCTCTCGTTCTCAAATGCGAGCAAAT...

Protein

Download Protein FASTA

207 aa · TkA08G302010|TK1151|PROTEIN

MAVEALIGAGVGDAVSKLSDAIIHVLKTTWQFRSKLTQIQETITSNKLIFDEIEKLIEELDRPKEEKEKFAAQMKGAEALVLKCEQIKWRFWKKYHHALKLDDLTASLLRFCQIDLQLMMMMGVMNLLVAKDVQMRMIKGDAARWSSGAPLLKGVVIGFDERLTDLKAMVLKQSAGGRIQKNRFTRALPPLNGLSGLRWAYFDYKPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G302010`
TK1151 ID	TkA08G302010
OH-1004 ID	LXL04_031513
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.600
Protein coverage (%)	TK1151 98.551 / OH-1004 87.554 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G302010

Location Chr08:78214638-78215261 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66900`	Probable disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031513 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.682

Rank 1 · TkA08G302010 · TK1151

Endoplasmic reticulum0.144

Rank 2 · TkA08G302010 · TK1151

Cytoplasm0.128

Rank 3 · TkA08G302010 · TK1151

Nucleus0.079

Rank 4 · TkA08G302010 · TK1151

Extracellular0.060

Rank 5 · TkA08G302010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07956DUF16903-84 aa

PF05659RPW84-129 aa

PF03418Peptidase_A2510-74 aa

PF10368YkyA15-77 aa

PF29645CHCH3_N35-41 aa

PF17675APG6_N37-102 aa

PF29645CHCH3_N52-75 aa

PF23404FAZ1_C54-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G302010	`PF07956`	DUF1690	3	84	0.057	14.6
TkA08G302010	`PF05659`	RPW8	4	129	1.6e-23	83.6
TkA08G302010	`PF03418`	Peptidase_A25	10	74	0.2	11.2
TkA08G302010	`PF10368`	YkyA	15	77	0.045	14.2
TkA08G302010	`PF29645`	CHCH3_N	35	41	0.063	14.1
TkA08G302010	`PF17675`	APG6_N	37	102	0.0016	19.6
TkA08G302010	`PF29645`	CHCH3_N	52	75	0.063	14.1
TkA08G302010	`PF23404`	FAZ1_C	54	71	0.29	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKZ1`	Arabidopsis thaliana	sp\|Q9FKZ1\|DRL42_ARATH Probable disease resistance protein At5g66900	25.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card