TkA08G295490 | RubberDandelionOmics

Gene overview

TkA08G295490

Reference: TK1151 Chr: Chr08 Coordinates: 76577695-76586070 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2342 bp · TkA08G295490|TK1151|cDNA

TTTTATACCTCGATCTGTCTGTCGCTAACACGGGCCTTGAGAATATAATTAGGATTTAGGAGGTTCATTTCACTAGGAACGTCAACCCCACATTATTCATCACATTTCTCTCGTATTAGCTAATTACCATCGGTACCTTCTTCAGACCTCAACCCCCGTTGTGATTTTCAATATTTGGCTTGTTCTGGAATCAAATGAATAAGATGGGTATGGAAGACGGAAGAAGTGGATTGGTCGTTGATCATTCCCACCCAAAGGCT...

CDS

Download CDS FASTA

1020 bp · TkA08G295490|TK1151|CDS

ATGGTACGAAGATTTAAGGACGACTTTCATCCGCAGGGACCATACGGTGTAGTTTGTCTGAGTCAGCATTGGGCAAGCTACCGATGTGGCCCCGATTTCCTTGATTCTGACTGGAGGAAAGTAGCAGCACCGACACCTCTATCATCTTCAACATCTGACATGTTGATCCGACTTGATCAACAGGCAGACACCAAAAAAAAATTTCTTCTGCTCTTCTCGCCGGCAATCTTCTCCTTGATTCTCACCGGAGGAGCAGCAAC...

Protein

Download Protein FASTA

339 aa · TkA08G295490|TK1151|PROTEIN

MVRRFKDDFHPQGPYGVVCLSQHWASYRCGPDFLDSDWRKVAAPTPLSSSTSDMLIRLDQQADTKKKFLLLFSPAIFSLILTGGAATLSPPASSFGITRLPKVSINSLYGAPTQGYKKYDVVLLVGIGIGATPLINIVQDILSNIKAIEEEEEENASTSTGKKQKKKRGPTNFKTTKAYFYWVTKEQSSFDWFKDVINEALEMDKNGVIDMNTYCTSVYNEDDARSAFITMLQSLYHEKHGVDVVSGTFVKSHFSKPNWR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G295490`
TK1151 ID	TkA08G295490
OH-1004 ID	LXL04_033658
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 69.322 / OH-1004 39.460 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G295490

Location Chr08:76577695-76586070 (-)

Description Similar to RBOHC: Respiratory burst oxidase homolog protein C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51060`	Calcium-dependent NADPH oxidase that generates superoxide.	Reactive oxygen species produced by NADPH oxidase regulate plant cell growth.2003 · DOI: 10.1038/nature01485 Hydrogen peroxide mediates plant root cell response to nutrient deprivation.2004 · DOI: 10.1073/pnas.0401707101
`At5g07390`	Calcium-dependent NADPH oxidase that generates superoxide.	No verified direct reference in this release
`At5g47910`	Calcium-dependent NADPH oxidase that generates superoxide.	Arabidopsis gp91phox homologues AtrbohD and AtrbohF are required for accumulation of reactive oxygen intermediates in the plant defense response.2002 · DOI: 10.1073/pnas.012452499 NADPH oxidase AtrbohD and AtrbohF genes function in ROS-dependent ABA signaling in Arabidopsis.2003 · DOI: 10.1093/emboj/cdg277 Cytosolic ascorbate peroxidase 1 is a central component of the reactive oxygen gene network of Arabidopsis.2005 · DOI: 10.1105/tpc.104.026971 Extracellular ATP induces the accumulation of superoxide via NADPH oxidases in Arabidopsis.2006 · DOI: 10.1104/pp.105.073072 The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x Arabidopsis thaliana expresses multiple lines of defense to counterattack Erwinia chrysanthemi.2007 · DOI: 10.1094/mpmi-20-7-0794 The MAP4 Kinase SIK1 Ensures Robust Extracellular ROS Burst and Antibacterial Immunity in Plants.2018 · DOI: 10.1016/j.chom.2018.08.007

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033658 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009060 aerobic respiration Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0033198 response to ATP Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004601 peroxidase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0016174 NAD(P)H oxidase H2O2-forming activity Molecular Function

KEGG gene cross-reference

ath:AT5G51060

sot:102586476

sot:102598898

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.272

Rank 1 · TkA08G295490 · TK1151

Endoplasmic reticulum0.191

Rank 2 · TkA08G295490 · TK1151

Nucleus0.177

Rank 3 · TkA08G295490 · TK1151

Cell membrane0.174

Rank 4 · TkA08G295490 · TK1151

Plastid0.122

Rank 5 · TkA08G295490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08030NAD_binding_628-42 aa

PF08030NAD_binding_6119-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G295490	`PF08030`	NAD_binding_6	28	42	4.9e-46	157.3
TkA08G295490	`PF08030`	NAD_binding_6	119	293	4.9e-46	157.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81210`	Arabidopsis thaliana	sp\|O81210\|RBOHC_ARATH Respiratory burst oxidase homolog protein C	56.700%	Swiss-Prot	Medium
`O81209`	Arabidopsis thaliana	sp\|O81209\|RBOHA_ARATH Respiratory burst oxidase homolog protein A	56.400%	Swiss-Prot	Medium
`Q9FIJ0`	Arabidopsis thaliana	sp\|Q9FIJ0\|RBOHD_ARATH Respiratory burst oxidase homolog protein D	44.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card