RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G293170
Reference: TK1151 Chr: Chr08 Coordinates: 75985106-75995628 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2016 bp · TkA08G293170|TK1151|cDNA

GTTTTACTTTTATGTGTTTATGGCTCACACAAGCTTGATGGAACTGTTTATAAGGTCAACTGGTTATGTAATAGACCTGGGCTTGAAAAGTCAGTAAGGCACGATCATTTCCTCTTGGAAGGTCACCACCATAGCACCGCCACCGGACCACCACCGCTGCTGCGACACGGTTCTTTTTCTCCCTCTTCGCTAGTCGATTTCACAGACTAGGGAGGTTCGAGAATCGCCCATCCGACCTTACACACCCTCGGAATCGAGAA...

CDS

Download CDS FASTA

1032 bp · TkA08G293170|TK1151|CDS

ATGGACAAAGATTCCCAAGAGTTTGCTGGGGAGGTGTTCGATGCATTAACTCGAAGGAGGAACATAATAGTTGACTCGGTTAACAAACAAATAATGAAGGATTTTCTCAACCAAATTTCTCTTCAGAGTTTTGACTCAAGGCTACAGACTTTCTTAGACATGATTGATACAGATGGTGATGGTAGGATCACAAAGGACGATGTCACAAAGATTATTAGGCTCAGTGCTTCAACCAACAAGTTACCGAATATTGAGAACCA...

Protein

Download Protein FASTA

343 aa · TkA08G293170|TK1151|PROTEIN

MDKDSQEFAGEVFDALTRRRNIIVDSVNKQIMKDFLNQISLQSFDSRLQTFLDMIDTDGDGRITKDDVTKIIRLSASTNKLPNIENQGDKYAAFIMEELDPDNLGYLMIESLEMLLLRAQHNVREESVNLKTRQSGNPVRRWYQDLSFPNVSINGSHGAPVEDYKIYEVVLLVGSGTPIIDIVKDILNKNKAIEDEEKNGTGKGKTGRTRAYFYLVTSDQGSFDMFKDIINEAAEMDKNVIEMNTYCTSVFPEDDARSAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G293170
TK1151 IDTkA08G293170
OH-1004 IDLXL04_033657
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.300
Protein coverage (%)TK1151 100.000 / OH-1004 39.290
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G293170
LocationChr08:75985106-75995628 (+)
DescriptionSimilar to RBOHC: Respiratory burst oxidase homolog protein C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g51060 Calcium-dependent NADPH oxidase that generates superoxide.
Reactive oxygen species produced by NADPH oxidase regulate plant cell growth.2003 · DOI: 10.1038/nature01485
Hydrogen peroxide mediates plant root cell response to nutrient deprivation.2004 · DOI: 10.1073/pnas.0401707101
At5g47910 Calcium-dependent NADPH oxidase that generates superoxide.
Arabidopsis gp91phox homologues AtrbohD and AtrbohF are required for accumulation of reactive oxygen intermediates in the plant defense response.2002 · DOI: 10.1073/pnas.012452499
NADPH oxidase AtrbohD and AtrbohF genes function in ROS-dependent ABA signaling in Arabidopsis.2003 · DOI: 10.1093/emboj/cdg277
Cytosolic ascorbate peroxidase 1 is a central component of the reactive oxygen gene network of Arabidopsis.2005 · DOI: 10.1105/tpc.104.026971
Extracellular ATP induces the accumulation of superoxide via NADPH oxidases in Arabidopsis.2006 · DOI: 10.1104/pp.105.073072
The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x
Arabidopsis thaliana expresses multiple lines of defense to counterattack Erwinia chrysanthemi.2007 · DOI: 10.1094/mpmi-20-7-0794
The MAP4 Kinase SIK1 Ensures Robust Extracellular ROS Burst and Antibacterial Immunity in Plants.2018 · DOI: 10.1016/j.chom.2018.08.007
At5g07390 Calcium-dependent NADPH oxidase that generates superoxide. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033657 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009060 aerobic respiration Biological Process
GO:0010053 root epidermal cell differentiation Biological Process
GO:0033198 response to ATP Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004601 peroxidase activity Molecular Function
GO:0005509 calcium ion binding Molecular Function
GO:0016174 NAD(P)H oxidase H2O2-forming activity Molecular Function
KEGG gene cross-reference
ath:AT5G51060
sot:102586476
sot:102598898
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482
Rank 1 · TkA08G293170 · TK1151
Nucleus0.192
Rank 2 · TkA08G293170 · TK1151
Cell membrane0.146
Rank 3 · TkA08G293170 · TK1151
Endoplasmic reticulum0.086
Rank 4 · TkA08G293170 · TK1151
Extracellular0.072
Rank 5 · TkA08G293170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08414NADPH_Ox3-46 aa
PF09447Cnl2_NKP212-34 aa
PF05733Tenui_N22-75 aa
PF13499EF-hand_746-106 aa
PF13833EF-hand_846-67 aa
PF00036EF-hand_148-73 aa
PF13405EF-hand_648-73 aa
PF13202EF-hand_548-67 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G293170PF08414NADPH_Ox3461.3e-1042.2
TkA08G293170PF09447Cnl2_NKP212340.07913.8
TkA08G293170PF05733Tenui_N22750.1212.6
TkA08G293170PF13499EF-hand_7461065e-0627.5
TkA08G293170PF13833EF-hand_846670.007816.7
TkA08G293170PF00036EF-hand_148731.4e-0525.0
TkA08G293170PF13405EF-hand_648734.6e-0523.5
TkA08G293170PF13202EF-hand_548670.0006919.7
TkA08G293170PF13499EF-hand_7931275e-0627.5
TkA08G293170PF00036EF-hand_1951101.4e-0525.0
TkA08G293170PF13833EF-hand_8951090.007816.7
TkA08G293170PF13405EF-hand_6971154.6e-0523.5
TkA08G293170PF09447Cnl2_NKP21341470.07913.8
TkA08G293170PF08030NAD_binding_61673267.1e-32111.3
TkA08G293170PF09447Cnl2_NKP22482720.07913.8
TkA08G293170PF08414NADPH_Ox2882991.3e-1042.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O81210Arabidopsis thalianasp|O81210|RBOHC_ARATH Respiratory burst oxidase homolog protein C28.700%Swiss-ProtLow
Q9FIJ0Arabidopsis thalianasp|Q9FIJ0|RBOHD_ARATH Respiratory burst oxidase homolog protein D57.900%Swiss-ProtMedium
O81209Arabidopsis thalianasp|O81209|RBOHA_ARATH Respiratory burst oxidase homolog protein A52.900%Swiss-ProtMedium

JBrowse

View in Genome Browser