TkA08G292060 | RubberDandelionOmics

Gene overview

TkA08G292060

Reference: TK1151 Chr: Chr08 Coordinates: 75725196-75728195 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2898 bp · TkA08G292060|TK1151|cDNA

ATGCTAACTCTCTTAAATCTGTCAGAAAATAAACGCCTATTCATAAACTCCACTTCCTTATGTCAACTCCCATTTGGGTTAGAGCAGATTATACTTTCGAATTCGGGTGTCACCGGTTCCATTCCTGATAAATTTCTGGTCAATTTTAAAAATCTTGCCGTTATCAATCTATCCCGGAATAGTCTAACTGGGTTTTTTCCAGAAACCCTAGTGTCTAATCCTGATTTGGTTCAAGTTCTTGATCTTTCTTCTAATAGCAT...

CDS

Download CDS FASTA

2898 bp · TkA08G292060|TK1151|CDS

ATGCTAACTCTCTTAAATCTGTCAGAAAATAAACGCCTATTCATAAACTCCACTTCCTTATGTCAACTCCCATTTGGGTTAGAGCAGATTATACTTTCGAATTCGGGTGTCACCGGTTCCATTCCTGATAAATTTCTGGTCAATTTTAAAAATCTTGCCGTTATCAATCTATCCCGGAATAGTCTAACTGGGTTTTTTCCAGAAACCCTAGTGTCTAATCCTGATTTGGTTCAAGTTCTTGATCTTTCTTCTAATAGCAT...

Protein

Download Protein FASTA

965 aa · TkA08G292060|TK1151|PROTEIN

MLTLLNLSENKRLFINSTSLCQLPFGLEQIILSNSGVTGSIPDKFLVNFKNLAVINLSRNSLTGFFPETLVSNPDLVQVLDLSSNSIYGSIPVTISSYTNLKNLNLSYNMITGWIPPELGNLCESLLELGLSFNNITGAIPAWFSSCSWLRVLDLSNNNLTGPFPDSMFQNMSSLEQLILSNNKISGSFPATISFCKKLRIVDFSSNMLSGTFPSGICPGASSLEELRVPDNLISGQIPEELSECWKLRTIDLSLNYLNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G292060`
TK1151 ID	TkA08G292060
OH-1004 ID	LXL04_033652
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.400
Protein coverage (%)	TK1151 100.000 / OH-1004 90.081 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G292060

Location Chr08:75725196-75728195 (-)

Description Similar to BRL2: Serine/threonine-protein kinase BRI1-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01950`	Receptor with a serine/threonine-protein kinase activity, which may transduce extracellular spatial and temporal signals into downstream cell differentiation responses in provascular and procambial cells.	VH1/BRL2 receptor-like kinase interacts with vascular-specific adaptor proteins VIT and VIK to influence leaf venation.2009 · DOI: 10.1111/j.1365-313x.2008.03742.x
`At3g13380`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403
`At1g55610`	Receptor with a serine/threonine-protein kinase activity.	BRL1, a leucine-rich repeat receptor-like protein kinase, is functionally redundant with BRI1 in regulating Arabidopsis brassinosteroid signaling.2004 · DOI: 10.1111/j.1365-313x.2004.02214.x BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0114400`	May be involved in brassenosteroid (BR) perception.	No verified direct reference in this release
`Os09g0293500`	May be involved in brassenosteroid (BR) perception in roots.	The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033652 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010233 phloem transport Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G55610

ath:AT2G01950

ath:AT3G13380

dosa:Os10g0114400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.876

Rank 1 · TkA08G292060 · TK1151

Endoplasmic reticulum0.080

Rank 2 · TkA08G292060 · TK1151

Cytoplasm0.069

Rank 3 · TkA08G292060 · TK1151

Nucleus0.049

Rank 4 · TkA08G292060 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA08G292060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00560LRR_12-23 aa

PF13855LRR_82-24 aa

PF13516LRR_62-11 aa

PF29594LRR_SKP225-182 aa

PF00560LRR_127-45 aa

PF13855LRR_827-87 aa

PF12799LRR_427-63 aa

PF25013LRR_Zer-145-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G292060	`PF00560`	LRR_1	2	23	1.7e-53	167.7
TkA08G292060	`PF13855`	LRR_8	2	24	1.7e-45	153.3
TkA08G292060	`PF13516`	LRR_6	2	11	0.1	13.4
TkA08G292060	`PF29594`	LRR_SKP2	25	182	0.01	15.8
TkA08G292060	`PF00560`	LRR_1	27	45	1.7e-53	167.7
TkA08G292060	`PF13855`	LRR_8	27	87	1.7e-45	153.3
TkA08G292060	`PF12799`	LRR_4	27	63	1.7e-36	124.1
TkA08G292060	`PF25013`	LRR_Zer-1	45	109	3.6e-05	24.7
TkA08G292060	`PF00560`	LRR_1	51	70	1.7e-53	167.7
TkA08G292060	`PF24758`	LRR_At5g56370	52	111	0.004	17.6
TkA08G292060	`PF29460`	LRR_NXF2	56	89	0.5	10.9
TkA08G292060	`PF25372`	LRR_FBXL15	72	110	0.00013	21.3
TkA08G292060	`PF23598`	LRR_14	76	129	1.3e-16	61.0
TkA08G292060	`PF13855`	LRR_8	77	136	1.7e-45	153.3
TkA08G292060	`PF00560`	LRR_1	78	96	1.7e-53	167.7
TkA08G292060	`PF12799`	LRR_4	78	111	1.7e-36	124.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPS9`	Arabidopsis thaliana	sp\|Q9ZPS9\|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2	76.400%	Swiss-Prot	Medium
`Q9LJF3`	Arabidopsis thaliana	sp\|Q9LJF3\|BRL3_ARATH Receptor-like protein kinase BRI1-like 3	61.600%	Swiss-Prot	Medium
`Q9ZWC8`	Arabidopsis thaliana	sp\|Q9ZWC8\|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1	59.800%	Swiss-Prot	Medium
`Q7G768`	Oryza sativa subsp. japonica	sp\|Q7G768\|BRL2_ORYSJ Brassinosteroid LRR receptor kinase BRL2	71.300%	Swiss-Prot	Medium
`Q69JN6`	Oryza sativa subsp. japonica	sp\|Q69JN6\|BRL1_ORYSJ Brassinosteroid LRR receptor kinase BRL1	61.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card