TkA08G291960 | RubberDandelionOmics

Gene overview

TkA08G291960

Reference: TK1151 Chr: Chr08 Coordinates: 75686700-75690222 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1461 bp · TkA08G291960|TK1151|cDNA

CAAAACCCCACTACACCTTTCATCAAGACTCCTGCAGTTTCAAATTTGAAGCATTTTCTGACAAAATTATCAAATTGCATCAAATCAAAAGCTGATCGAATCAAATTCATCACCAGATCGAGTGAAAAAGATGGCAGCAAAGCAAATGGAAGAAATACAGAGGAAATTAACGCTGTTAGCTTACCCAAGAGCCAATGCCCCTTCTCAGTCTCTTCTCTTTGCCGGCATGGAGCGCTACTCCCTTCTCGAATGGCTGTTTT...

CDS

Download CDS FASTA

1005 bp · TkA08G291960|TK1151|CDS

ATGGCAGCAAAGCAAATGGAAGAAATACAGAGGAAATTAACGCTGTTAGCTTACCCAAGAGCCAATGCCCCTTCTCAGTCTCTTCTCTTTGCCGGCATGGAGCGCTACTCCCTTCTCGAATGGCTGTTTTTCAAGCTATTGGGTGATAAATCCCCCTTTTCTCAACAAAATTTACATGGGGATGCCATGGATCGGGACGAAGAGACCTCTCGCATCCAATATTTGGCAGAGATTGCAAAGTTTCTTGGCATAACCACTAC...

Protein

Download Protein FASTA

334 aa · TkA08G291960|TK1151|PROTEIN

MAAKQMEEIQRKLTLLAYPRANAPSQSLLFAGMERYSLLEWLFFKLLGDKSPFSQQNLHGDAMDRDEETSRIQYLAEIAKFLGITTTVDTEAIQGRGSYEERTEMLRLIVDLVEASIYADNPEWSVDEQVAKDIQLIDSIAEKQAQIFSEECKLFPADVQIQSIYPLPDISDLEKQLASQSSRLLSLQEMVDDLASKHSYNPDEDYAEVDMKLRAHLESFLETARSFNTIYTKEIRPWTHMMEVPQLHGFGPAANRLLEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G291960`
TK1151 ID	TkA08G291960
OH-1004 ID	LXL04_033650
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G291960

Location Chr08:75686700-75690222 (-)

Description Similar to AUG7: AUGMIN subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17620`	Contributes to the assembly of the acentrosomal spindle and phragmoplast microtubule arrays as part of the augmin complex.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033650 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031023 microtubule organizing center organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0005876 spindle microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0070652 HAUS complex Cellular Component

GO:0051011 microtubule minus-end binding Molecular Function

KEGG gene cross-reference

ath:AT5G17620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · TkA08G291960 · TK1151

Nucleus0.299

Rank 2 · TkA08G291960 · TK1151

Golgi apparatus0.105

Rank 3 · TkA08G291960 · TK1151

Cell membrane0.078

Rank 4 · TkA08G291960 · TK1151

Lysosome / Vacuole0.070

Rank 5 · TkA08G291960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28715DUF84455-14 aa

PF06694Plant_NMP16-324 aa

PF04632FUSC46-229 aa

PF08581Tup_N94-108 aa

PF28715DUF8445169-224 aa

PF08581Tup_N172-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G291960	`PF28715`	DUF8445	5	14	0.16	12.5
TkA08G291960	`PF06694`	Plant_NMP1	6	324	1.5e-195	649.4
TkA08G291960	`PF04632`	FUSC	46	229	0.29	10.4
TkA08G291960	`PF08581`	Tup_N	94	108	0.054	14.5
TkA08G291960	`PF28715`	DUF8445	169	224	0.16	12.5
TkA08G291960	`PF08581`	Tup_N	172	219	0.054	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WTP1`	Arabidopsis thaliana	sp\|Q0WTP1\|AUG7_ARATH AUGMIN subunit 7	79.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card