TkA08G289300 | RubberDandelionOmics

Gene overview

TkA08G289300

Reference: TK1151 Chr: Chr08 Coordinates: 75067028-75069111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1325 bp · TkA08G289300|TK1151|cDNA

AGTCAACGTGCTCACCCACTCTATACTGCTCCATTGGGCATTACAAGACCGCCTCCGTCATTCACATCGTTCTGTACTTCTGTTTTCAACACAATGGCCGATCAAAACCGGAATTCGAGAACTACTAGTCAATTTACATGCAAGAATTATACGAATTCAGGGTTCCAGCTGTCCTCACTGGTAGCTACGAATGGATCTCCTGTTTTTTCAATTCCGGCTCCATCAGAGAGAGAATTTATCGGGACGTTTGGTTCAAATCT...

CDS

Download CDS FASTA

1161 bp · TkA08G289300|TK1151|CDS

AGTCAACGTGCTCACCCACTCTATACTGCTCCATTGGGCATTACAAGACCGCCTCCGTCATTCACATCGTTCTGTACTTCTGTTTTCAACACAATGGCCGATCAAAACCGGAATTCGAGAACTACTAGTCAATTTACATGCAAGAATTATACGAATTCAGGGTTCCAGCTGTCCTCACTGGTAGCTACGAATGGATCTCCTGTTTTTTCAATTCCGGCTCCATCAGAGAGAGAATTTATCGGGACGTTTGGTTCAAATCT...

Protein

Download Protein FASTA

386 aa · TkA08G289300|TK1151|PROTEIN

SQRAHPLYTAPLGITRPPPSFTSFCTSVFNTMADQNRNSRTTSQFTCKNYTNSGFQLSSLVATNGSPVFSIPAPSEREFIGTFGSNLFWASFAAVVSKTISNRAVRKAFTENDREMMGLPKKPDEITKSMSMRERWSTRIKNLRVSTTNVIRYIPTQALNFVFKDYFNNFFHFKKDDDGHLKWFPGNFISGGAAGASSLLLMYSLDNAWKRLAIDEAKKAGERQFTGLVDVYKKTLASNGVSGLYRGFNISCIGAIVYRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G289300`
TK1151 ID	TkA08G289300
OH-1004 ID	LXL04_004429
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.800
Protein coverage (%)	TK1151 91.710 / OH-1004 96.845 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G289300

Location Chr08:75067028-75069111 (+)

Description Similar to ANT: ADP,ATP carrier protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13490`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0718900`	ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004429 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015865 purine nucleotide transport Biological Process

GO:0046902 regulation of mitochondrial membrane permeability Biological Process

GO:0140021 mitochondrial ADP transmembrane transport Biological Process

GO:1990544 mitochondrial ATP transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005757 mitochondrial permeability transition pore complex Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT3G08580

ath:AT5G13490

ghi:107926278

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.869

Rank 1 · TkA08G289300 · TK1151

Cytoplasm0.046

Rank 2 · TkA08G289300 · TK1151

Plastid0.045

Rank 3 · TkA08G289300 · TK1151

Cell membrane0.024

Rank 4 · TkA08G289300 · TK1151

Nucleus0.024

Rank 5 · TkA08G289300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20585Pectate_lyase_529-57 aa

PF00153Mito_carr83-101 aa

PF20585Pectate_lyase_5131-156 aa

PF00153Mito_carr147-174 aa

PF00153Mito_carr184-273 aa

PF00153Mito_carr281-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G289300	`PF20585`	Pectate_lyase_5	29	57	0.49	11.3
TkA08G289300	`PF00153`	Mito_carr	83	101	1.3e-34	118.5
TkA08G289300	`PF20585`	Pectate_lyase_5	131	156	0.49	11.3
TkA08G289300	`PF00153`	Mito_carr	147	174	1.3e-34	118.5
TkA08G289300	`PF00153`	Mito_carr	184	273	1.3e-34	118.5
TkA08G289300	`PF00153`	Mito_carr	281	370	1.3e-34	118.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P40941`	Arabidopsis thaliana	sp\|P40941\|ADT2_ARATH ADP/ATP translocase 2, mitochondrial	54.900%	Swiss-Prot	High
`P31691`	Oryza sativa subsp. japonica	sp\|P31691\|ADT_ORYSJ ADP/ATP translocase, mitochondrial	64.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card