TkA08G288810 | RubberDandelionOmics

Gene overview

TkA08G288810

Reference: TK1151 Chr: Chr08 Coordinates: 74952478-74953008 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkA08G288810|TK1151|cDNA

ATGTTATCTGATCCAAACATGGCCATGGATATGATGAAGAAAAATCTTTCAATGATCATACCACAGACCCTTACTTTTGCATGGGTCAACTTCTTCTTCTCCGGATTTGTAGCAGCAAAGATACCTTTTCCTTTGACTCAGAGGTTTAGATCAATGTTACAAAACGGAATTGACTTGAGCACTGTTGATGTTAGCTATGTCAGCAGTCGATCATGGTATGTCTTAAGAGGTTTGTTTAGTCTCATTAATCTGTTTGGATT...

CDS

Download CDS FASTA

321 bp · TkA08G288810|TK1151|CDS

ATGTTATCTGATCCAAACATGGCCATGGATATGATGAAGAAAAATCTTTCAATGATCATACCACAGACCCTTACTTTTGCATGGGTCAACTTCTTCTTCTCCGGATTTGTAGCAGCAAAGATACCTTTTCCTTTGACTCAGAGGTTTAGATCAATGTTACAAAACGGAATTGACTTGAGCACTGTTGATGTTAGCTATGTCAGCAGTCGATCATGGTATGTCTTAAGAGGTTTGTTTAGTCTCATTAATCTGTTTGGATT...

Protein

Download Protein FASTA

106 aa · TkA08G288810|TK1151|PROTEIN

MLSDPNMAMDMMKKNLSMIIPQTLTFAWVNFFFSGFVAAKIPFPLTQRFRSMLQNGIDLSTVDVSYVSSRSWYVLRGLFSLINLFGLRGLFSLILGEENGKFRFCT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G288810`
TK1151 ID	TkA08G288810
OH-1004 ID	LXL04_034756
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.000
Protein coverage (%)	TK1151 47.170 / OH-1004 14.620 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G288810`
Location	Chr08:74952478-74953008 (+)
Description	Similar to emc3: ER membrane protein complex subunit 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034756` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0034975 protein folding in endoplasmic reticulum Biological Process GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence Biological Process GO:0045494 photoreceptor cell maintenance Biological Process GO:0071816 tail-anchored membrane protein insertion into ER membrane Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0030140 trans-Golgi network transport vesicle Cellular Component GO:0072546 EMC complex Cellular Component GO:0032977 membrane insertase activity Molecular Function
KEGG gene cross-reference	dre:406826 hsa:55831 mmu:66087 pon:100173356 rno:312640 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.368

Rank 1 · TkA08G288810 · TK1151

Plastid0.232

Rank 2 · TkA08G288810 · TK1151

Cytoplasm0.094

Rank 3 · TkA08G288810 · TK1151

Golgi apparatus0.083

Rank 4 · TkA08G288810 · TK1151

Peroxisome0.061

Rank 5 · TkA08G288810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01956EMC3_TMCO16-99 aa

PF27070HTH_Rpn_C50-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G288810	`PF01956`	EMC3_TMCO1	6	99	3.1e-28	99.4
TkA08G288810	`PF27070`	HTH_Rpn_C	50	62	0.051	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card