TkA08G288240 | RubberDandelionOmics

Gene overview

TkA08G288240

Reference: TK1151 Chr: Chr08 Coordinates: 74819089-74821009 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1726 bp · TkA08G288240|TK1151|cDNA

CTTAGACATAAAAGTCCGACAACGAAAGTCCGACAACGGGTAAAGTGCAATGCAAAAAACATTAAAGTGTAAATTTCCCAGACTTTACTTTTTGGCGGACACAATACCCACAAAAAATATGATGATCTGATGAGTATTTTCTTCATTTCATGTGATGTGGTGATTTATTTGGCAGGTGGAATTGAGGCTAACGCTACAAATAGAACTGCATACTGGAAGTGGCAACCTAATAATCTGAATCCACTCAAATGGCGATAAAA...

CDS

Download CDS FASTA

1161 bp · TkA08G288240|TK1151|CDS

ATGGCAGTCGAACTACCATTAGAACTCGTCGAGCAAATCCTGTCAAGGCTGCCATCAAAATCGCTTCTCAGATGCCGATCCGTATGCAAATCATGGCTCGCTCTCATCTCTTCCGCCCAATTCCGCCTCATGCATCTTCACAGTTTTAACCAACTCAACTCTCGCTATCTTGTTCGTCGCTTGATACGAAATGAGGAAGAATACGCTCTTCATTTCGATGACCAACATTTCACTCTGGATACCAGTTCTTCCATACAAGC...

Protein

Download Protein FASTA

386 aa · TkA08G288240|TK1151|PROTEIN

MAVELPLELVEQILSRLPSKSLLRCRSVCKSWLALISSAQFRLMHLHSFNQLNSRYLVRRLIRNEEEYALHFDDQHFTLDTSSSIQALSIFDIGEKVYYIEIIGSCNGVICLWPDALERDEIVLWNPSIRRKVTLIPPVYRESDVDIRYGFGYHKTSDDYKVVRLAYDPRLDPNPAPQVQIYSTKAGNWRAVVFPNDLPPIIEYDCSQVLNGSVHWISFDRLVIRYTILTFDMSTELFGEIQIPKSAIHKGARGMKLAVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G288240`
TK1151 ID	TkA08G288240
OH-1004 ID	LXL04_033624
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	48.800
Protein coverage (%)	TK1151 91.969 / OH-1004 97.521 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G288240

Location Chr08:74819089-74821009 (-)

Description Similar to At3g23880: F-box/kelch-repeat protein At3g23880

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At3g10240`	Putative F-box protein At3g10240.	No verified direct reference in this release
`At3g21410`	F-box/WD-40 repeat-containing protein 1.	No verified direct reference in this release
`At2g27520`	F-box/LRR-repeat/kelch-repeat protein At2g27520.	No verified direct reference in this release
`At2g43260`	F-box/LRR-repeat protein At2g43260.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033624 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G07870

ath:AT3G23880

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.576

Rank 1 · TkA08G288240 · TK1151

Nucleus0.416

Rank 2 · TkA08G288240 · TK1151

Cell membrane0.132

Rank 3 · TkA08G288240 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA08G288240 · TK1151

Lysosome / Vacuole0.050

Rank 5 · TkA08G288240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box4-41 aa

PF12937F-box-like4-38 aa

PF07734FBA_182-307 aa

PF08268FBA_395-328 aa

PF24750b-prop_At3g26010-like103-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G288240	`PF00646`	F-box	4	41	1.2e-10	41.6
TkA08G288240	`PF12937`	F-box-like	4	38	2.6e-09	37.4
TkA08G288240	`PF07734`	FBA_1	82	307	2.8e-24	86.4
TkA08G288240	`PF08268`	FBA_3	95	328	6.4e-16	59.0
TkA08G288240	`PF24750`	b-prop_At3g26010-like	103	304	1e-05	25.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	28.900%	Swiss-Prot	Low
`Q9SS35`	Arabidopsis thaliana	sp\|Q9SS35\|FB137_ARATH Putative F-box protein At3g10240	25.900%	Swiss-Prot	Low
`Q4PSN6`	Arabidopsis thaliana	sp\|Q4PSN6\|FBW1_ARATH F-box/WD-40 repeat-containing protein 1	26.500%	Swiss-Prot	Low
`Q9ZNQ3`	Arabidopsis thaliana	sp\|Q9ZNQ3\|FBLK3_ARATH F-box/LRR-repeat/kelch-repeat protein At2g27520	24.500%	Swiss-Prot	Low
`Q8S8Q9`	Arabidopsis thaliana	sp\|Q8S8Q9\|FBL40_ARATH F-box/LRR-repeat protein At2g43260	27.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card