TkA08G282950 | RubberDandelionOmics

Gene overview

TkA08G282950

Reference: TK1151 Chr: Chr08 Coordinates: 73506069-73506746 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

556 bp · TkA08G282950|TK1151|cDNA

CAATAGTCAACCTATCAACAACTTTGTCAAATAATTAAGAAGAAAGTCACGAAATATGCAGACCATCAAGGATAAAATAACCGATTTAAATGCGACCCGTAAGGCCAGGTCTGAAGCTAAAAATGAGGAAAAGGTAGAGAAAGATTTGGCTAAATCGAGGGCAGAAGTAGCTCATGAAATAAGGCTGGCGAAAGAAGCTGAAGCTTCAATGGAGGCCCATGTAAACAAGGCAGTTGAAAAGGCAGCCCAACACGACGCCA...

CDS

Download CDS FASTA

333 bp · TkA08G282950|TK1151|CDS

ATGCAGACCATCAAGGATAAAATAACCGATTTAAATGCGACCCGTAAGGCCAGGTCTGAAGCTAAAAATGAGGAAAAGGTAGAGAAAGATTTGGCTAAATCGAGGGCAGAAGTAGCTCATGAAATAAGGCTGGCGAAAGAAGCTGAAGCTTCAATGGAGGCCCATGTAAACAAGGCAGTTGAAAAGGCAGCCCAACACGACGCCAAACAACAAAGCCAACAAGAGAGCCATAGTACAGACAACATAAATAGTTCTTCAAA...

Protein

Download Protein FASTA

110 aa · TkA08G282950|TK1151|PROTEIN

MQTIKDKITDLNATRKARSEAKNEEKVEKDLAKSRAEVAHEIRLAKEAEASMEAHVNKAVEKAAQHDAKQQSQQESHSTDNINSSSNSASSNPSGGNDKSNIPGHLSKFM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G282950`
TK1151 ID	TkA08G282950
OH-1004 ID	LXL04_033609
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G282950`
Location	Chr08:73506069-73506746 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033609` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006970 response to osmotic stress Biological Process GO:0009414 response to water deprivation Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0048316 seed development Biological Process GO:0005829 cytosol Cellular Component GO:0009506 plasmodesma Cellular Component
KEGG gene cross-reference	ath:AT1G32560 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · TkA08G282950 · TK1151

Nucleus0.307

Rank 2 · TkA08G282950 · TK1151

Cell membrane0.212

Rank 3 · TkA08G282950 · TK1151

Mitochondrion0.122

Rank 4 · TkA08G282950 · TK1151

Golgi apparatus0.033

Rank 5 · TkA08G282950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03760LEA_11-72 aa

PF30022Spc25_N_drosophila11-78 aa

PF04502Saf4_Yju211-91 aa

PF04791LMBR112-84 aa

PF20079DUF647413-82 aa

PF09440eIF3_N14-73 aa

PF09805Nop2515-98 aa

PF10500SR-2516-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G282950	`PF03760`	LEA_1	1	72	8.9e-12	46.1
TkA08G282950	`PF30022`	Spc25_N_drosophila	11	78	0.17	13.1
TkA08G282950	`PF04502`	Saf4_Yju2	11	91	2.5	8.4
TkA08G282950	`PF04791`	LMBR1	12	84	6.5	6.2
TkA08G282950	`PF20079`	DUF6474	13	82	1.5	9.4
TkA08G282950	`PF09440`	eIF3_N	14	73	2.3	9.3
TkA08G282950	`PF09805`	Nop25	15	98	0.18	13.0
TkA08G282950	`PF10500`	SR-25	16	95	0.32	11.3
TkA08G282950	`PF27836`	GIP4	21	107	1.0	8.5
TkA08G282950	`PF22016`	DUF6933	23	87	0.022	15.3
TkA08G282950	`PF18757`	Nmad5	25	81	0.0026	19.0
TkA08G282950	`PF12546`	Cryptochrome_C	26	91	0.021	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card