TkA08G272030 | RubberDandelionOmics

Gene overview

TkA08G272030

Reference: TK1151 Chr: Chr08 Coordinates: 70847358-70847750 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA08G272030|TK1151|cDNA

ATGTCTTCTTCGGTGGAAAACCTAGAAAAATATCGAATTCCAATCAACGAGATCCTTCGGGTCACAAGAAACTTCAGTTCAGAAACTCTGATCGGAGATGGTGGATTCGGTTTAGTCCACAAAGGGCAACTCTCCGAAGAATGGCAAAAACGCATAGTAGCCATCAAACGCCTAAATCGAGATGGTTATCAAGGAAACAACGAGTTCCAAAATGAACTCAAGATGGTTTCGAGTTTCAAACATCCAAACATCATTACTTT...

CDS

Download CDS FASTA

393 bp · TkA08G272030|TK1151|CDS

ATGTCTTCTTCGGTGGAAAACCTAGAAAAATATCGAATTCCAATCAACGAGATCCTTCGGGTCACAAGAAACTTCAGTTCAGAAACTCTGATCGGAGATGGTGGATTCGGTTTAGTCCACAAAGGGCAACTCTCCGAAGAATGGCAAAAACGCATAGTAGCCATCAAACGCCTAAATCGAGATGGTTATCAAGGAAACAACGAGTTCCAAAATGAACTCAAGATGGTTTCGAGTTTCAAACATCCAAACATCATTACTTT...

Protein

Download Protein FASTA

130 aa · TkA08G272030|TK1151|PROTEIN

MSSSVENLEKYRIPINEILRVTRNFSSETLIGDGGFGLVHKGQLSEEWQKRIVAIKRLNRDGYQGNNEFQNELKMVSSFKHPNIITFIGYCDDNNEMIIVYDYAKNASLDRHLQRPEKMRSLTWGQRLKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G272030`
TK1151 ID	TkA08G272030
OH-1004 ID	LXL04_033539
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 21.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G272030

Location Chr08:70847358-70847750 (+)

Description Similar to At5g59700: Probable receptor-like protein kinase At5g59700

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g20530`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g76370`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033539 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT3G46290

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.568

Rank 1 · TkA08G272030 · TK1151

Nucleus0.313

Rank 2 · TkA08G272030 · TK1151

Cell membrane0.266

Rank 3 · TkA08G272030 · TK1151

Mitochondrion0.055

Rank 4 · TkA08G272030 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA08G272030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase26-118 aa

PF07714PK_Tyr_Ser-Thr28-119 aa

PF25904Tmrp11_N43-119 aa

PF09868DUF209547-106 aa

PF05669Med3155-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G272030	`PF00069`	Pkinase	26	118	5.6e-16	59.5
TkA08G272030	`PF07714`	PK_Tyr_Ser-Thr	28	119	1.9e-17	64.2
TkA08G272030	`PF25904`	Tmrp11_N	43	119	0.017	15.4
TkA08G272030	`PF09868`	DUF2095	47	106	0.029	14.9
TkA08G272030	`PF05669`	Med31	55	121	0.17	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	43.000%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	43.000%	Swiss-Prot	Medium
`F4JEQ2`	Arabidopsis thaliana	sp\|F4JEQ2\|PBL23_ARATH Probable serine/threonine-protein kinase PBL23	39.700%	Swiss-Prot	Medium
`Q9SFX0`	Arabidopsis thaliana	sp\|Q9SFX0\|PBL22_ARATH Probable serine/threonine-protein kinase PBL22	45.200%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card