TkA08G271510 | RubberDandelionOmics

Gene overview

TkA08G271510

Reference: TK1151 Chr: Chr08 Coordinates: 70706741-70707100 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · TkA08G271510|TK1151|cDNA

ATGGCGCACAATCGCCAACCTGACCTCAAACCTAATCATCATTCTTCATCGGAGGACGAGGAAGAAGAGGAGGAAGAAGCCTCTGGTTCAGAAGATGAACAAACATCCGACTCAGGATCAGAAGAAGAAGTCTCCGATTCAGATTCTGAACCGAAACAAACACCGGAGCCAAAGAAGCCCGCAATAGCACCTCGTCAACCCGTTAGCAAACCACAAGTACCAGATCTGTCGTCATCTGAAACAGAGGAATCAGGTTCTGA...

CDS

Download CDS FASTA

360 bp · TkA08G271510|TK1151|CDS

ATGGCGCACAATCGCCAACCTGACCTCAAACCTAATCATCATTCTTCATCGGAGGACGAGGAAGAAGAGGAGGAAGAAGCCTCTGGTTCAGAAGATGAACAAACATCCGACTCAGGATCAGAAGAAGAAGTCTCCGATTCAGATTCTGAACCGAAACAAACACCGGAGCCAAAGAAGCCCGCAATAGCACCTCGTCAACCCGTTAGCAAACCACAAGTACCAGATCTGTCGTCATCTGAAACAGAGGAATCAGGTTCTGA...

Protein

Download Protein FASTA

119 aa · TkA08G271510|TK1151|PROTEIN

MAHNRQPDLKPNHHSSSEDEEEEEEEASGSEDEQTSDSGSEEEVSDSDSEPKQTPEPKKPAIAPRQPVSKPQVPDLSSSETEESGSDTDSDSQPKNRPSRIPTLANLVETYGPRGRSEP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G271510`
TK1151 ID	TkA08G271510
OH-1004 ID	LXL04_033535
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.600
Protein coverage (%)	TK1151 79.832 / OH-1004 31.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G271510`
Location	Chr08:70706741-70707100 (-)
Description	Similar to RCOM_0699480: Glycosyltransferase family 92 protein RCOM_0530710
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033535` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000138 Golgi trans cisterna Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0016757 glycosyltransferase activity Molecular Function
KEGG gene cross-reference	ath:AT1G27200 rcu:8270359 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · TkA08G271510 · TK1151

Cytoplasm0.264

Rank 2 · TkA08G271510 · TK1151

Mitochondrion0.024

Rank 3 · TkA08G271510 · TK1151

Cell membrane0.024

Rank 4 · TkA08G271510 · TK1151

Extracellular0.023

Rank 5 · TkA08G271510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23980Phage_tail_tube_init4-70 aa

PF15250Raftlin13-67 aa

PF04147Nop1414-80 aa

PF04931DNA_pol_phi15-77 aa

PF09073BUD2215-98 aa

PF29052PGA28-like_dom15-94 aa

PF02724CDC4518-52 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G271510	`PF23980`	Phage_tail_tube_init	4	70	9.6	6.5
TkA08G271510	`PF15250`	Raftlin	13	67	8.1	5.7
TkA08G271510	`PF04147`	Nop14	14	80	2.4	7.0
TkA08G271510	`PF04931`	DNA_pol_phi	15	77	0.82	8.5
TkA08G271510	`PF09073`	BUD22	15	98	8.2	6.3
TkA08G271510	`PF29052`	PGA28-like_dom	15	94	9.5	6.6
TkA08G271510	`PF02724`	CDC45	18	52	8.2	5.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card