TkA08G270070 | RubberDandelionOmics

Gene overview

TkA08G270070

Reference: TK1151 Chr: Chr08 Coordinates: 70353135-70357502 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1751 bp · TkA08G270070|TK1151|cDNA

CCCAAACATATAAAATGCCGATTCAGTCTACGACCAACGGCATTTACACACTCCACGACATTCGCCAGTGCTCAAACGGCAACCACCTCCACTCTGCTATACTTCCCCCAAATTCTCAACGTAATTCAACCATAGATTGTGTTATGATCGCAAATCGAGCTGTTCCGGGTTCAATATGCCGATTGTCACACGTTTTTTTATGAGAATTTCTCGATCAGCTCCATCGAACGGGAAATTGGGTATAGGGTTTTGGCAACGGA...

CDS

Download CDS FASTA

1314 bp · TkA08G270070|TK1151|CDS

ATGCCGATTGTCACACGTTTTTTTATGAGAATTTCTCGATCAGCTCCATCGAACGGGAAATTGGGTATAGGGTTTTGGCAACGGAGGTTTATGAGGGTTTTGACGTGTGAGGAGCAGGAATTGGTCAATGAAACTGACAGTGTTAAGAACCAGAGATTTGTGGCTGTATGGGGCAATGGTGATTATGGGAGGTTGGGTTTGGGTAGCGTGGAATCCAAATGGAGGCCTGCTCTTTGTTCGGCTTTTGGCGATGGAAATCT...

Protein

Download Protein FASTA

437 aa · TkA08G270070|TK1151|PROTEIN

MPIVTRFFMRISRSAPSNGKLGIGFWQRRFMRVLTCEEQELVNETDSVKNQRFVAVWGNGDYGRLGLGSVESKWRPALCSAFGDGNLREIACGGAHTLFLTDAGNVYASGLNDCGQLGVSDGRGYTIDPLEVSGLPNNIVKVSAGYYHSSAITENGELYMWGKNSSGQLGLGKKAGKVIPVPSKVEFLNGVPIKMAALGSDHSISVTETGEVLSWGGGESGRLGHGHKSSLLGFLSSTSEYTPRLIKELEGVKIKSVAAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G270070`
TK1151 ID	TkA08G270070
OH-1004 ID	LXL04_033513
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G270070

Location Chr08:70353135-70357502 (-)

Description Similar to UVR8: Ultraviolet-B receptor UVR8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63860`	UV-B specific signaling component that acts as a UV-B photoreceptor and plays a key role in establishing UV-protective responses in plants.	A UV-B-specific signaling component orchestrates plant UV protection.2005 · DOI: 10.1073/pnas.0507187102 UV-B promotes rapid nuclear translocation of the Arabidopsis UV-B specific signaling component UVR8 and activates its function in the nucleus.2007 · DOI: 10.1105/tpc.107.053330 UV-B signaling pathways with different fluence-rate response profiles are distinguished in mature Arabidopsis leaf tissue by requirement for UVR8, HY5, and HYH.2008 · DOI: 10.1104/pp.107.108456 Interaction of COP1 and UVR8 regulates UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2009 · DOI: 10.1038/emboj.2009.4 UVR8 in Arabidopsis thaliana regulates multiple aspects of cellular differentiation during leaf development in response to ultraviolet B radiation.2009 · DOI: 10.1111/j.1469-8137.2009.02855.x Negative feedback regulation of UV-B-induced photomorphogenesis and stress acclimation in Arabidopsis.2010 · DOI: 10.1073/pnas.0914532107 Functional interaction of the circadian clock and UV RESISTANCE LOCUS 8-controlled UV-B signaling pathways in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04573.x Perception of UV-B by the Arabidopsis UVR8 protein.2011 · DOI: 10.1126/science.1200660 UVR8 mediates UV-B-induced Arabidopsis defense responses against Botrytis cinerea by controlling sinapate accumulation.2012 · DOI: 10.1093/mp/sss025 C-terminal region of the UV-B photoreceptor UVR8 initiates signaling through interaction with the COP1 protein.2012 · DOI: 10.1073/pnas.1210898109 In vivo function of tryptophans in the Arabidopsis UV-B photoreceptor UVR8.2012 · DOI: 10.1105/tpc.112.101451 The UV-B photoreceptor UVR8 promotes photosynthetic efficiency in Arabidopsis thaliana exposed to elevated levels of UV-B.2012 · DOI: 10.1007/s11120-012-9785-y

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033513 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009411 response to UV Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0010224 response to UV-B Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function

GO:0009881 photoreceptor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G63860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.791

Rank 1 · TkA08G270070 · TK1151

Cytoplasm0.112

Rank 2 · TkA08G270070 · TK1151

Nucleus0.092

Rank 3 · TkA08G270070 · TK1151

Plastid0.081

Rank 4 · TkA08G270070 · TK1151

Peroxisome0.022

Rank 5 · TkA08G270070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25390WD40_RLD54-430 aa

PF00415RCC156-100 aa

PF13540RCC1_256-63 aa

PF13540RCC1_289-116 aa

PF25384Alsin_RLD89-118 aa

PF13953PapC_C101-124 aa

PF23333VWC2L_1st102-110 aa

PF00415RCC1104-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G270070	`PF25390`	WD40_RLD	54	430	2.7e-90	304.0
TkA08G270070	`PF00415`	RCC1	56	100	7.8e-79	260.8
TkA08G270070	`PF13540`	RCC1_2	56	63	1.5e-50	168.5
TkA08G270070	`PF13540`	RCC1_2	89	116	1.5e-50	168.5
TkA08G270070	`PF25384`	Alsin_RLD	89	118	2.3e-08	34.3
TkA08G270070	`PF13953`	PapC_C	101	124	0.0032	18.0
TkA08G270070	`PF23333`	VWC2L_1st	102	110	0.11	13.1
TkA08G270070	`PF00415`	RCC1	104	152	7.8e-79	260.8
TkA08G270070	`PF13540`	RCC1_2	139	168	1.5e-50	168.5
TkA08G270070	`PF25384`	Alsin_RLD	140	170	2.3e-08	34.3
TkA08G270070	`PF13953`	PapC_C	149	169	0.0032	18.0
TkA08G270070	`PF00415`	RCC1	155	204	7.8e-79	260.8
TkA08G270070	`PF25384`	Alsin_RLD	184	225	2.3e-08	34.3
TkA08G270070	`PF13540`	RCC1_2	197	221	1.5e-50	168.5
TkA08G270070	`PF00415`	RCC1	210	267	7.8e-79	260.8
TkA08G270070	`PF25384`	Alsin_RLD	246	322	2.3e-08	34.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN03`	Arabidopsis thaliana	sp\|Q9FN03\|UVR8_ARATH Ultraviolet-B receptor UVR8	32.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card