TkA08G269000 | RubberDandelionOmics

Gene overview

TkA08G269000

Reference: TK1151 Chr: Chr08 Coordinates: 70123210-70125946 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1617 bp · TkA08G269000|TK1151|cDNA

CTAATATAAGCTTGTTTCAAAAAAAAGAAATCATATTTAATATATCTATAAATAACTCAAGGATGGGTAAGTTCTCAAATAATTTAGAGGTGGGTAATTTGTAATCCCTAAGTTCCGAAATTATTGAACATTCAGAAAAACTCCTTGCTCGTTTAGTGTGTTTGTCGAAGTGATGATGGAGAGTAAAAGGAGAAGGGTTGCCAGCTGTGCTGAGGAGGATAGGATCAGCAACTTGCCAGAACACTTAATAGAATCGATCT...

CDS

Download CDS FASTA

1305 bp · TkA08G269000|TK1151|CDS

ATGATGGAGAGTAAAAGGAGAAGGGTTGCCAGCTGTGCTGAGGAGGATAGGATCAGCAACTTGCCAGAACACTTAATAGAATCGATCTTGGAGGGGCTCCCGATTGAAGAGGCTGTAAGAACAAGCATCATATCTAAAAAGTGGAGATACAGATGGACGACAATGAGGGCCTTGGTTTTTAATCAGAATTTCTCCAGTAAATTTGCAAACAACGGAGCTTTTAGTCGTAATGGGGTTATAAGGATCATAAACCAAGTCTT...

Protein

Download Protein FASTA

434 aa · TkA08G269000|TK1151|PROTEIN

MMESKRRRVASCAEEDRISNLPEHLIESILEGLPIEEAVRTSIISKKWRYRWTTMRALVFNQNFSSKFANNGAFSRNGVIRIINQVLFLHNGPILKFHLHIPNMFLDSFQEIDQWVLFLSRNGVTDLVLTNSSYSRYELPSYLFSCLELTKLDLVKCFYKPPLEFQGFHNLEDLRLVNIDFKTSLCGDKINLPWLKRLRMGKCTNAHNFNIEATKLEFLNVVACPDVMLLQLLDSPCLIQVGIVFQNLPQDFAPREKMTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G269000`
TK1151 ID	TkA08G269000
OH-1004 ID	LXL04_033497
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 54.729 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G269000

Location Chr08:70123210-70125946 (+)

Description Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13570`	F-box/FBD/LRR-repeat protein At1g13570.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At1g80960`	F-box protein At1g80960.	No verified direct reference in this release
`At2g05300`	Putative F-box/FBD/LRR-repeat protein At2g05300.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033497 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT1G32375

ath:AT2G04230

ath:AT3G58860

ath:AT5G38590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.817

Rank 1 · TkA08G269000 · TK1151

Cytoplasm0.243

Rank 2 · TkA08G269000 · TK1151

Endoplasmic reticulum0.036

Rank 3 · TkA08G269000 · TK1151

Cell membrane0.031

Rank 4 · TkA08G269000 · TK1151

Plastid0.023

Rank 5 · TkA08G269000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box18-55 aa

PF12937F-box-like18-49 aa

PF08387FBD88-96 aa

PF24758LRR_At5g56370112-331 aa

PF08387FBD293-329 aa

PF24758LRR_At5g56370299-375 aa

PF08387FBD360-399 aa

PF24758LRR_At5g56370384-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G269000	`PF00646`	F-box	18	55	6.2e-07	29.8
TkA08G269000	`PF12937`	F-box-like	18	49	0.046	14.2
TkA08G269000	`PF08387`	FBD	88	96	0.00011	22.8
TkA08G269000	`PF24758`	LRR_At5g56370	112	331	5.1e-09	36.8
TkA08G269000	`PF08387`	FBD	293	329	0.00011	22.8
TkA08G269000	`PF24758`	LRR_At5g56370	299	375	5.1e-09	36.8
TkA08G269000	`PF08387`	FBD	360	399	0.00011	22.8
TkA08G269000	`PF24758`	LRR_At5g56370	384	403	5.1e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ70`	Arabidopsis thaliana	sp\|Q9FZ70\|FDL1_ARATH F-box/FBD/LRR-repeat protein At1g13570	32.500%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	32.600%	Swiss-Prot	Low
`Q9SAG4`	Arabidopsis thaliana	sp\|Q9SAG4\|FB93_ARATH F-box protein At1g80960	27.400%	Swiss-Prot	Low
`Q9SJ32`	Arabidopsis thaliana	sp\|Q9SJ32\|FDL15_ARATH Putative F-box/FBD/LRR-repeat protein At2g05300	24.800%	Swiss-Prot	Low
`Q9LYZ2`	Arabidopsis thaliana	sp\|Q9LYZ2\|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930	24.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card